[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09161.1
DDBJ      :             virulence protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09161.1 GT:GENE ABF09161.1 GT:PRODUCT virulence protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2504104..2504430) GB:FROM 2504104 GB:TO 2504430 GB:DIRECTION - GB:PRODUCT virulence protein GB:PROTEIN_ID ABF09161.1 GB:DB_XREF GI:93355072 LENGTH 108 SQ:AASEQ MKRWLFAAFGVTAALMSGAAMAHVSVGVAIGVPGVVIGAPAYYPPAPVYYAPPPVVVAPGPAYYGPPPVVVRPAPVYYGGYGYYRGGPRYYYGPGWHGRGHGHGRWHD GT:EXON 1|1-108:0| TM:NTM 2 TM:REGION 11->33| TM:REGION 50->72| SEG 26->107|vgvaigvpgvvigapayyppapvyyapppvvvapgpayygpppvvvrpapvyyggygyyrggpryyygpgwhgrghghgrwh| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,102-109| PSIPRED ccEEEHHHHHHHHHHHccccEEEEEEEEEEcccEEEEccccccccccEEEccccEEEcccccccccccEEEEccccEEcccccccccccEEEcccccccccccccccc //