Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09165.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09165.1 GT:GENE ABF09165.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2508258..2508719) GB:FROM 2508258 GB:TO 2508719 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09165.1 GB:DB_XREF GI:93355076 LENGTH 153 SQ:AASEQ MSSSLITTVEKVIGKQRLSALVHDSFPAPIPKGSSASLFLSRDCLRVVAMSVTTVATNADTIQHRHLAGWQSGYAAACKAVYAGSIPTSASSLKQNGARCGAVLLFGLSLIQFLWDIADFLRLLSHWLAWCACYITSGRTAFGTTLGVAIHLA GT:EXON 1|1-153:0| TM:NTM 1 TM:REGION 105->127| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEHHHHHHHHHHHHHHEEccHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccEEEEEEEEc //