[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09174.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->222 PF08900 * DUF1845 2e-85 68.9 %
:HMM:PFM   10->224 PF08900 * DUF1845 7.9e-93 53.0 215/217  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09174.1 GT:GENE ABF09174.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2516156..2516947 GB:FROM 2516156 GB:TO 2516947 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09174.1 GB:DB_XREF GI:93355085 LENGTH 263 SQ:AASEQ MATSNEPLQLNLGSLRSAMSLTLHTHHASRIWHGRAAAEGRPGIVGLNGYIAVMNKMKRGSEQDDPYSDWWMLRIEEKLDQTRTTLQSLREQVDQALAGVPAALSLGENLNVQPVKLPLFVNAQLGFAAVYLLADYDDIARKLILAHHTALIDRSTLERWLNEGAHALRSLFSLAQQYRYSGCTRDDFAAKNAAARAALEKFGELPQDVLEGMRRSKFAPPVVRRGLQQRGDSAAAAASPTDEGAAADSAEAKSTAAGEDEPA GT:EXON 1|1-263:0| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 71->100| SEG 189->198|aaknaaaraa| SEG 241->258|tdegaaadsaeakstaag| RP:PFM:NREP 1 RP:PFM:REP 11->222|PF08900|2e-85|68.9|212/217|DUF1845| HM:PFM:NREP 1 HM:PFM:REP 10->224|PF08900|7.9e-93|53.0|215/217|DUF1845| OP:NHOMO 58 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------5-----------------------1---1--1---113-1-----1----------------1-1---------------------------------------------------------------1-1-------1--------------------1--1---------11----------------------------------11--1111--------11-1--2---------1--------1------------------------1-11----11--------------111-111---11---1--------------------------1-211---1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,5-5,220-264| PSIPRED cccccccccccccccccccEEEHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccEEEEEEEccHHHHHHHHHHHcHHHHHHHHHHHHccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHcccccccccccccccHHHHHHHccHHccccccccccccHHHHHHccccccccc //