[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09187.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   73->197 2z5yA PDBj 5e-04 29.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09187.1 GT:GENE ABF09187.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2528435..2529121 GB:FROM 2528435 GB:TO 2529121 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09187.1 GB:DB_XREF GI:93355098 LENGTH 228 SQ:AASEQ MANNYYEATGVLVLDRVTPVIQALFGAFALDESHPGNGQAYIAQIAETTNPQWPDVLDGLEDLATQLGIPMPDDEGLSIPPLLELLAVHFRADEDEELGNLIDRHSFEDTADLDALFLIATRFDDGHHLTAIQFEGCWYCSKPRLFEFGGNGCYLSREVRFISSSSQALQLGDQLRKTIVAADIEEASALIALETINLLAGVSDEPFRMNLRRRVAERLAQTPTISVT GT:EXON 1|1-228:0| BL:PDB:NREP 1 BL:PDB:REP 73->197|2z5yA|5e-04|29.4|119/513| OP:NHOMO 13 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------1---1--1----12--------------------------1---------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------1-1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 52.2 SQ:SECSTR ########################################################################HHHHHTccTTcGGGcTTHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHcccGGGccHHHH##HHHHHTHHHHccTTcT####TcEEETTcTHHHHHHGGGEEccccEEEEEcccccEEEEETT############################### DISOP:02AL 1-3,227-229| PSIPRED ccccccccccEEEHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHHHcccccEEEEEEccEEEccccccEEEcccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccc //