[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09192.1
DDBJ      :             Mercuric transport protein MerT
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->97 PF02411 * MerT 2e-22 64.9 %
:HMM:PFM   1->116 PF02411 * MerT 2.4e-62 79.3 116/116  
:BLT:SWISS 1->96 MERT_SERMA 1e-30 59.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09192.1 GT:GENE ABF09192.1 GT:PRODUCT Mercuric transport protein MerT GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2532172..2532522 GB:FROM 2532172 GB:TO 2532522 GB:DIRECTION + GB:PRODUCT Mercuric transport protein MerT GB:PROTEIN_ID ABF09192.1 GB:DB_XREF GI:93355103 InterPro:IPR003457 LENGTH 116 SQ:AASEQ MSEPKNGCGALATGGVAAVLASACCLGPLVLVALGFSGAWIGNLTVLEPYRPIFIGAALIALFFAWRSIFRPAHACKPGDVCAVPQVRTAYKVIFWIVAALVLVALAFPYVLPLFY GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 1->96|MERT_SERMA|1e-30|59.4|96/116| TM:NTM 3 TM:REGION 16->38| TM:REGION 50->72| TM:REGION 90->112| SEG 7->23|gcgalatggvaavlasa| SEG 53->65|ifigaalialffa| SEG 98->114|vaalvlvalafpyvlpl| RP:PFM:NREP 1 RP:PFM:REP 24->97|PF02411|2e-22|64.9|74/114|MerT| HM:PFM:NREP 1 HM:PFM:REP 1->116|PF02411|2.4e-62|79.3|116/116|MerT| GO:PFM:NREP 3 GO:PFM GO:0015097|"GO:mercury ion transmembrane transporter activity"|PF02411|IPR003457| GO:PFM GO:0015694|"GO:mercury ion transport"|PF02411|IPR003457| GO:PFM GO:0016020|"GO:membrane"|PF02411|IPR003457| OP:NHOMO 49 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------------1-----------------11----------1-1-4---1----211-2----1-1------------13----------------------------------------------------------------1-23--1---------1-2--1----1-----------------------------------------------------------------1-----2-----------------------------1------------------------------------------121---1----1----------------------------1------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //