[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09196.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->16 PF01483 * P_proprotein 0.00046 61.5 13/87  
:HMM:PFM   28->48 PF11312 * DUF3115 0.00085 42.9 21/303  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09196.1 GT:GENE ABF09196.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2536173..2536457 GB:FROM 2536173 GB:TO 2536457 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09196.1 GB:DB_XREF GI:93355107 InterPro:IPR002197 LENGTH 94 SQ:AASEQ MSAARSRGTWTLEVTRLCTDGTPSACSKLYGAAWQAARALGYIRLLTYTMPDEGGASLRAAGWRLIGARGGGAWSRPGRPRADTPEHLRGAKCL GT:EXON 1|1-94:0| HM:PFM:NREP 2 HM:PFM:REP 4->16|PF01483|0.00046|61.5|13/87|P_proprotein| HM:PFM:REP 28->48|PF11312|0.00085|42.9|21/303|DUF3115| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------1------1---11--------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------1-----------------------------------------------1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- DISOP:02AL 1-8,73-81,94-95| PSIPRED ccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccEEcccEEEEEcccccccccccccccccHHHHcccccc //