[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09200.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->87 PF02316 * Mu_DNA_bind 0.00037 34.1 41/144  
:BLT:SWISS 37->109 RECXP_PSEPU 2e-06 34.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09200.1 GT:GENE ABF09200.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2539525..2539866 GB:FROM 2539525 GB:TO 2539866 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09200.1 GB:DB_XREF GI:93355111 LENGTH 113 SQ:AASEQ MSTIACDTPRSTLDEPAWRDLCKAAAAHAQRGCGLSYDHYVTLFSSAIDAQANRLPDEQRAQALEIAAQEWDYATPAERQETQDWNAEHGYCSHGIEFGYCPAGCDRDDDDWD GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 37->109|RECXP_PSEPU|2e-06|34.2|73/100| HM:PFM:NREP 1 HM:PFM:REP 47->87|PF02316|0.00037|34.1|41/144|Mu_DNA_bind| OP:NHOMO 21 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------1---------------------------------------------3-------------1--------11---1--------2-------1----------------1-------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------1---------------------------------------1-211---1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,81-82,109-114| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccccc //