[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09201.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09201.1 GT:GENE ABF09201.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2539971..2540378 GB:FROM 2539971 GB:TO 2540378 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09201.1 GB:DB_XREF GI:93355112 LENGTH 135 SQ:AASEQ MGWYFSNQSRSELIAELIAPQETERASVKVIAHTLRGNVLWSVAEVTAKVEGVHRDLAPGQSLRYIRCDLLERSGGQWGYKSLDESMHPYYYTCPLSYLDLAPEQSADWRAGVRAYHARRRTPTASAASAAASMA GT:EXON 1|1-135:0| SEG 125->134|asaasaaasm| OP:NHOMO 19 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-----------------------1---1------113-1-----1--------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------111---------------------------------------1-1-----1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,5-7,123-123,125-127,130-130,135-136| PSIPRED cccEEccccHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEcccccccccccccccccEEEcccHHHEEccccccHHHHHHHHHHHccccccccHHHHHHHHcc //