[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09202.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->61 PF06334 * Orthopox_A47 4.3e-05 39.2 51/244  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09202.1 GT:GENE ABF09202.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2540395..2540655 GB:FROM 2540395 GB:TO 2540655 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09202.1 GB:DB_XREF GI:93355113 LENGTH 86 SQ:AASEQ MDPILATLPPSLLALVEGSLSNDEVSSDEEMLAYFIDNGLTEDQARQALTYRDQYLNNIYLEGFTPITSADEPLHFNPHTRQFEPD GT:EXON 1|1-86:0| HM:PFM:NREP 1 HM:PFM:REP 9->61|PF06334|4.3e-05|39.2|51/244|Orthopox_A47| OP:NHOMO 16 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------1---1-------12-------1--------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------111-1-------------------------------------1-1-----1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,82-82,84-87| PSIPRED ccHHHHHccHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHcccccccccccEEccccHHHcccc //