[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09206.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 38->100 YLYB_BACSU 4e-05 23.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09206.1 GT:GENE ABF09206.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2543014..2543319 GB:FROM 2543014 GB:TO 2543319 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09206.1 GB:DB_XREF GI:93355117 LENGTH 101 SQ:AASEQ MASHRIETYCQRLAFPIGALIFSRGVDRLVRAGRLDPIPYFRRHTRGDWGDVNIQQWQTNSSALQSGASLESHYVIHPGLAIRIVTDSQRCATVIVLPSED GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 38->100|YLYB_BACSU|4e-05|23.8|63/100| OP:NHOMO 41 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6---1-------------1---------2------126-------2----------------1-1---------------------------------------------------------------2----------121------------------------------------------------------------------------------------------------------------------------------------------------------------112------------1----------------------------411------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,100-102| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEEEEEccccEEEEEEcccccEEEEEEcccc //