[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09223.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->76 PF11660 * DUF3262 5e-13 51.3 %
:HMM:PFM   1->76 PF11660 * DUF3262 2.5e-32 51.3 76/76  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09223.1 GT:GENE ABF09223.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2559784..2560017 GB:FROM 2559784 GB:TO 2560017 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09223.1 GB:DB_XREF GI:93355134 LENGTH 77 SQ:AASEQ MNGAQVSAFQANSGIAPSAMATVLVGVVFAVLLVWGVWAIRTAYVGWSESRLNQRQFLGVCIRFVAMYLVLSFFLLS GT:EXON 1|1-77:0| TM:NTM 2 TM:REGION 20->42| TM:REGION 55->77| SEG 23->39|vlvgvvfavllvwgvwa| RP:PFM:NREP 1 RP:PFM:REP 1->76|PF11660|5e-13|51.3|76/76|DUF3262| HM:PFM:NREP 1 HM:PFM:REP 1->76|PF11660|2.5e-32|51.3|76/76|DUF3262| OP:NHOMO 23 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------4-----------------------1---1--1---1-311-----1----------------1-----------------------------------------------------------------1---------------------------------1---------1-------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------1-1------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8| PSIPRED cccHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //