[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09232.1
DDBJ      :             DNA repair protein RadC
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  614/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   49->164 2qlcE PDBj 5e-18 31.0 %
:RPS:PFM   43->164 PF04002 * DUF2466 7e-30 46.7 %
:HMM:PFM   43->164 PF04002 * DUF2466 1.5e-44 49.2 122/123  
:BLT:SWISS 43->162 RADC_PSEU5 2e-35 58.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09232.1 GT:GENE ABF09232.1 GT:PRODUCT DNA repair protein RadC GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2568086..2568580 GB:FROM 2568086 GB:TO 2568580 GB:DIRECTION + GB:PRODUCT DNA repair protein RadC GB:PROTEIN_ID ABF09232.1 GB:DB_XREF GI:93355143 InterPro:IPR001405 LENGTH 164 SQ:AASEQ MSFVVNDSCLESLSAIAAQHEDWIIQQAIALLEKRVFKAGPKLLDPTAVRDYLRVKLVAEPNEIFVAVFLDSMHQVLAYEPLFRGTINATSVYPRVVVQRVLQLNAAAVVFAHQHPSGISEPSSADRMLTQQLQAALALIDVRVLDHIIVGQGAPFSFAESGLL GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 43->162|RADC_PSEU5|2e-35|58.3|120/224| SEG 131->139|qqlqaalal| BL:PDB:NREP 1 BL:PDB:REP 49->164|2qlcE|5e-18|31.0|116/124| RP:PFM:NREP 1 RP:PFM:REP 43->164|PF04002|7e-30|46.7|122/123|DUF2466| HM:PFM:NREP 1 HM:PFM:REP 43->164|PF04002|1.5e-44|49.2|122/123|DUF2466| OP:NHOMO 871 OP:NHOMOORG 623 OP:PATTERN -------------------------------------------1111--1111--------------- ----------------------------------------------------------------------------------11-1111221-1111--113111121-1--------------1111121111-2111--222---1111111111------1111--11-------------------12-111111-12-11-1111111111-1212211111111-112--1-11111---1111-111111111111111--11111-1-1111111111-11-----------1111111111111111111111111111-------1-11-111211211121-111--111211111113-111213-121111111-1-1111111111111111111-111111111-2--11111111111111-112211211111111111121111-1111111111-111--11-1----11-3-43-111211--171111111111122111111111121112-12121326322111142111111111111111314231123111111111111-32-2125111-1-11-----------------------1111233111121111211311132232221211---2113------11231214337446341-32426261453531142111213222221211111211111112123221---111121111232--11-1-111111-16111111112211-111111111-11112113121122222221111---------12311322422121411424351111111--11--------------1-1-------------------------1-1-111111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 70.7 SQ:SECSTR ################################################HHHHHTTccccTTccEEEEEEEcTTccEEEEEEEEcccccGGGccHHHHHHHHHHTTccEEEEEEEcTTccccccHHHHHHHHHHHHHHHHHTcEEEEEEEEccccEEETTTTTcc DISOP:02AL 1-1,40-41,118-125| PSIPRED ccEEEccccHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEEEEEEEcccEEEcHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccEEEEEEEEEccccEEEcHHcccc //