[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09236.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   78->98 PF09413 * DUF2007 0.00025 38.1 21/68  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09236.1 GT:GENE ABF09236.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2571539..2571895 GB:FROM 2571539 GB:TO 2571895 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09236.1 GB:DB_XREF GI:93355147 LENGTH 118 SQ:AASEQ MSAARMTWRPLRWLFSRRAAKALLWTVLIVAAAVAANIAGIYLVGSVAGWERWLAAAAGYLFVWRLCLYGATVYGWIWMRRRLLVREDDAQARHRLVRTEIAGVVAIVALEASLLMQG GT:EXON 1|1-118:0| TM:NTM 3 TM:REGION 24->46| TM:REGION 53->75| TM:REGION 96->117| SEG 22->41|allwtvlivaaavaaniagi| HM:PFM:NREP 1 HM:PFM:REP 78->98|PF09413|0.00025|38.1|21/68|DUF2007| OP:NHOMO 26 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------4---1-------------------1---1--1---1-3-1-----1----------------1-2---------------------------------------------------------------1---------------------------------1---------1-------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------121------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,86-90,118-119| PSIPRED ccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //