[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09258.1
DDBJ      :             histidine kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  152/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->112 1bxdA PDBj 2e-09 35.5 %
:RPS:PDB   23->114 1bxdA PDBj 4e-14 30.8 %
:RPS:SCOP  23->114 1bxdA  d.122.1.3 * 2e-14 30.8 %
:HMM:SCOP  2->108 1gkzA2 d.122.1.4 * 1.6e-18 28.0 %
:RPS:PFM   11->101 PF02518 * HATPase_c 9e-08 36.0 %
:HMM:PFM   18->101 PF02518 * HATPase_c 2.7e-20 32.1 84/111  
:BLT:SWISS 10->83 YEDV_ECOLI 2e-10 42.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09258.1 GT:GENE ABF09258.1 GT:PRODUCT histidine kinase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2594278..2594646) GB:FROM 2594278 GB:TO 2594646 GB:DIRECTION - GB:PRODUCT histidine kinase GB:PROTEIN_ID ABF09258.1 GB:DB_XREF GI:93355169 InterPro:IPR003594 InterPro:IPR004358 InterPro:IPR005467 LENGTH 122 SQ:AASEQ MLHFGIEAAYSPRDTAIEVGVFLDPNAQQCVISVSDRGPGLTAEQACQIGQRFWRGDQGRKSKDGAGLGISIVRAIAERFGGALNLEPREGGGLVAKFLVPTDPAPKKGQARPAGRGLDSKP GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 10->83|YEDV_ECOLI|2e-10|42.9|70/452| BL:PDB:NREP 1 BL:PDB:REP 17->112|1bxdA|2e-09|35.5|93/161| RP:PDB:NREP 1 RP:PDB:REP 23->114|1bxdA|4e-14|30.8|91/161| RP:PFM:NREP 1 RP:PFM:REP 11->101|PF02518|9e-08|36.0|89/112|HATPase_c| HM:PFM:NREP 1 HM:PFM:REP 18->101|PF02518|2.7e-20|32.1|84/111|HATPase_c| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 1 RP:SCP:REP 23->114|1bxdA|2e-14|30.8|91/161|d.122.1.3| HM:SCP:REP 2->108|1gkzA2|1.6e-18|28.0|107/193|d.122.1.4|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 192 OP:NHOMOORG 152 OP:PATTERN -------------------------------------------------------------------- -11---------------------1------1-111-211-111-----111-2111---34--2-1-1221------212--------------------------------------------------------111-----1--1----------1-21----1----1-----1-------11-----1----------------1----------------------1-----------------------11---------------2------------------------------------------------------------------------1------1---1-----------------1--1------1---------------------1-11-111------2---1----1---1-----1------------------111---------------------------------3-1-111-2---1---------11-------111113--11-3121-1112--11-1---1-----------1------1----1---1-1--112----12-11-1--------------------1---------------------1---1-11----1------1--------------------------------1-------------------1-----------------------------------------------111---1---------------------------1-11112422-2223-122--------------------------1-1------111--1-11------------1---------------------------------1----2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR TcHHHccTTccTcccccTTcccEEEETTEEEEEEEEEcccccTTGGGccccccccccccccccccccccccTTHHHHHHHTcEEEEEEETTTEEEEEEEEccccccccccccccHGGGEEEE DISOP:02AL 56-65,103-123| PSIPRED cccHHHHHcccccccEEEEEEEEEccccEEEEEEEEccccccHHHHHHHccccEEccccccccccccHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccccccccccccccccccc //