[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09263.1
DDBJ      :             heme exporter protein CcmB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  225/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->193 PF03379 * CcmB 5e-26 41.4 %
:HMM:PFM   12->224 PF03379 * CcmB 1.4e-76 54.0 213/215  
:BLT:SWISS 13->108 CCMB_HAEIN 3e-22 43.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09263.1 GT:GENE ABF09263.1 GT:PRODUCT heme exporter protein CcmB GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2598223..2598909 GB:FROM 2598223 GB:TO 2598909 GB:DIRECTION + GB:PRODUCT heme exporter protein CcmB GB:PROTEIN_ID ABF09263.1 GB:DB_XREF GI:93355174 InterPro:IPR003544 LENGTH 228 SQ:AASEQ MSRPLVANPVFVVMRRDLKLALLRRSDALIPLCFFVVVVSLFPLGIGPEREMLRRIAPGVLWVSALLASMLSLNRLFEQDHADGTLEQMMLSPAPLAMLVVGKIAAHWLLSGLPLALLAPALALQFDLPALSLWILTASLVIGTPVLSLIGAVGAGLTLGVRAGGVLVAVLVLPLYIPVLIFGAGAVDASIIGQGASANLSLLAAVFVLAAFFTPFAASASLRIALEY GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 13->108|CCMB_HAEIN|3e-22|43.8|96/221| TM:NTM 6 TM:REGION 27->49| TM:REGION 56->78| TM:REGION 96->118| TM:REGION 133->155| TM:REGION 167->189| TM:REGION 200->222| SEG 109->131|llsglplallapalalqfdlpal| SEG 149->173|ligavgagltlgvraggvlvavlvl| SEG 196->221|asanlsllaavfvlaafftpfaasas| RP:PFM:NREP 1 RP:PFM:REP 13->193|PF03379|5e-26|41.4|181/214|CcmB| HM:PFM:NREP 1 HM:PFM:REP 12->224|PF03379|1.4e-76|54.0|213/215|CcmB| GO:PFM:NREP 4 GO:PFM GO:0015232|"GO:heme transporter activity"|PF03379|IPR003544| GO:PFM GO:0015886|"GO:heme transport"|PF03379|IPR003544| GO:PFM GO:0016020|"GO:membrane"|PF03379|IPR003544| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF03379|IPR003544| OP:NHOMO 243 OP:NHOMOORG 226 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1----11------------11111111-1--111111111111-----1-111111--11111111111111-1------------------------------1------1-1-----------------------111221111-11----1-1----1-----1-------121111-----------------------------------------------------------11-111111111111111111111111111---1-1-------11--1-11111111111-1111111111111111111--111---222-22222222222111111111--111111111111---1---------1-1-1111111111111111-------11111111111----11-1111----------11111111111111--------------11--------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcc //