[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09272.1
DDBJ      :             Thioredoxin-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  317/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   146->258 1jfuB PDBj 2e-12 31.0 %
:RPS:PDB   146->263 3c73A PDBj 2e-19 26.5 %
:RPS:SCOP  157->263 1z5yE1  c.47.1.10 * 3e-25 29.5 %
:HMM:SCOP  102->265 1jfuA_ c.47.1.10 * 5.3e-35 28.0 %
:RPS:PFM   146->252 PF08534 * Redoxin 6e-16 38.7 %
:HMM:PFM   136->255 PF08534 * Redoxin 2.2e-20 26.3 118/146  
:HMM:PFM   2->101 PF01790 * LGT 1e-10 24.2 99/257  
:BLT:SWISS 152->260 YNEN_BACSU 2e-14 38.3 %
:PROS 161->179|PS00194|THIOREDOXIN_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09272.1 GT:GENE ABF09272.1 GT:PRODUCT Thioredoxin-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2606029..2606865 GB:FROM 2606029 GB:TO 2606865 GB:DIRECTION + GB:PRODUCT Thioredoxin-like protein GB:PROTEIN_ID ABF09272.1 GB:DB_XREF GI:93355183 InterPro:IPR006662 InterPro:IPR006663 InterPro:IPR011594 LENGTH 278 SQ:AASEQ MISVGPFSVQVVAVFLAVLLAWAVARMVAKRLPDSPYKAAGGMLLDAAFVGFVAARLGYIAQWWEEYAQSPMSMISIGDQGFSWWVGVLAALALIWWRTRAVRALRRPVLAGVAVGLAAWFATGGVLALLQRSAPPLPALTLATLDEQPVVLNSYAGRPVVLNLWASWCPPCRREMPVFEQAQAQYPDIAFVMVNQGESAQQARAFLESERLHLKDVLLDPASQTMQAVASRGLPTTLFFDEQGRLVDTHLGELTMASLKHTVSRRFAPAQQIKTDKE GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 152->260|YNEN_BACSU|2e-14|38.3|107/170| PROS 161->179|PS00194|THIOREDOXIN_1|PDOC00172| TM:NTM 5 TM:REGION 5->27| TM:REGION 39->61| TM:REGION 77->98| TM:REGION 109->131| TM:REGION 149->170| SEG 9->29|vqvvavflavllawavarmva| SEG 100->119|ravralrrpvlagvavglaa| SEG 134->145|applpaltlatl| BL:PDB:NREP 1 BL:PDB:REP 146->258|1jfuB|2e-12|31.0|113/177| RP:PDB:NREP 1 RP:PDB:REP 146->263|3c73A|2e-19|26.5|117/136| RP:PFM:NREP 1 RP:PFM:REP 146->252|PF08534|6e-16|38.7|106/132|Redoxin| HM:PFM:NREP 2 HM:PFM:REP 136->255|PF08534|2.2e-20|26.3|118/146|Redoxin| HM:PFM:REP 2->101|PF01790|1e-10|24.2|99/257|LGT| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 157->263|1z5yE1|3e-25|29.5|105/136|c.47.1.10| HM:SCP:REP 102->265|1jfuA_|5.3e-35|28.0|164/176|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 461 OP:NHOMOORG 318 OP:PATTERN -------------------------------------------------------------------- 422-2----------------1111------11-1111121-111--1----------11--4--1--1-1-------------1------------------2-1--11---------------21-------3-32212---22-------------------------------------11223-1-23211111112111111123333211324221-3------222----------------------------------------------------1--22222222222-------------1---------1-1-21111111-1------111311--2--1-11----1--1---1---2-3-11-211-1111112111111111111111211-121121-1111------221111112--1111111111---------1--11211-----------------------------11-21-2221122223211111111111111-221---1-1---21-211122--1124-121--------13-121------11----------1---1-----3---------------------------1--11-1332-11-22332-3133332311322---1212--------------------------------------------------------------------------------------------1----------1111--------------------------1111111111111121-----------2---------1----22112111111-1-111----------------1--------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 47.8 SQ:SECSTR #################################################################################################################################################TccEEEGGGGTTcEEEEEEEcTTcHHHHHHHHHHHHHHHHHGTEEEEEEEccccHHHHHHHHHHHTTccccEEEcTTcHHHHHTTcccccEEEEEcTTccEEEEEcccccHHHHHHHHHHHHHHHHHcEEccc DISOP:02AL 1-2,29-39,267-279| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccccccEEEEEccccEEEHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccccEEEEcccHHHHHHHccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccccc //