[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09276.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.114.1
:107 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  11->106 1l1sA  c.114.1.1 * 6e-17 29.2 %
:HMM:SCOP  7->107 1l1sA_ c.114.1.1 * 5.4e-14 25.7 %
:HMM:PFM   18->106 PF02635 * DrsE 9.3e-09 28.6 84/119  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09276.1 GT:GENE ABF09276.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2609989..2610312 GB:FROM 2609989 GB:TO 2610312 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09276.1 GB:DB_XREF GI:93355187 LENGTH 107 SQ:AASEQ MTQDTQRPTLKVILHAPTAEAFERARSNATNLKRAAPDADVRIVANAQAVAAALDTAPSDLDALTWVCPNTLSRIGRDNREPLEVLDGPAVIEMARMQQAGWIYIRA GT:EXON 1|1-107:0| SEG 45->57|anaqavaaaldta| HM:PFM:NREP 1 HM:PFM:REP 18->106|PF02635|9.3e-09|28.6|84/119|DrsE| RP:SCP:NREP 1 RP:SCP:REP 11->106|1l1sA|6e-17|29.2|96/111|c.114.1.1| HM:SCP:REP 7->107|1l1sA_|5.4e-14|25.7|101/0|c.114.1.1|1/1|DsrEFH-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHcccccccHHHHcccHHHHHcccccccHHHHcccHHHHHHHHHHHHcccEEcc //