[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09281.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 46->140 CU077_PANTR 2e-04 26.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09281.1 GT:GENE ABF09281.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2613969..2614538 GB:FROM 2613969 GB:TO 2614538 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09281.1 GB:DB_XREF GI:93355192 LENGTH 189 SQ:AASEQ MSPLLCRAMKETSAVCHALLQTPAFFALLRRIDEDLMKVARDRGCCHCGSVLHSANYPRKPRGCPPAAHPDCNTRLSLCCAGCRKRMTPDSVRFLGRRVWLAIVLVLRSSRATGACLDGLPAISWATLKRWRQWWTETFPKTPVGRWLRGLIPPTPEPFIYPDCLLQSVEHDSEDERLAAVLLLLLGPA GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 46->140|CU077_PANTR|2e-04|26.9|93/100| SEG 178->186|laavlllll| OP:NHOMO 38 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------61--------2---C------------------1---------------------2--------------------7---------------------------------33--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,7-7| PSIPRED ccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHcccccccccccHHHHHHHHHcccHHHHHHHHHHHHHccc //