[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09289.1
DDBJ      :             translation elongation factor P (EF-P)
Swiss-Prot:EFP_RALME    RecName: Full=Elongation factor P;         Short=EF-P;

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
b.34.5b.40.4
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->185 1uebA PDBj 2e-24 39.9 %
:RPS:PDB   1->124 2eifA PDBj 5e-27 21.3 %
:RPS:SCOP  1->63 1uebA1  b.34.5.2 * 4e-15 30.2 %
:RPS:SCOP  65->126 1uebA2  b.40.4.5 * 4e-19 32.8 %
:RPS:SCOP  128->185 1uebA3  b.40.4.5 * 8e-14 49.1 %
:HMM:SCOP  1->63 1uebA1 b.34.5.2 * 1.3e-15 44.4 %
:HMM:SCOP  64->126 1uebA2 b.40.4.5 * 8.8e-19 51.6 %
:HMM:SCOP  127->185 1uebA3 b.40.4.5 * 2e-16 60.3 %
:RPS:PFM   67->120 PF01132 * EFP 3e-08 51.9 %
:RPS:PFM   131->184 PF09285 * Elong-fact-P_C 5e-13 64.2 %
:HMM:PFM   129->184 PF09285 * Elong-fact-P_C 1.4e-25 60.0 55/56  
:HMM:PFM   67->120 PF01132 * EFP 1.5e-20 44.4 54/55  
:HMM:PFM   4->60 PF08207 * EFP_N 1.4e-19 33.3 57/58  
:BLT:SWISS 1->186 EFP_RALME e-105 100.0 %
:PROS 150->169|PS01275|EFP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09289.1 GT:GENE ABF09289.1 GT:PRODUCT translation elongation factor P (EF-P) GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2622776..2623336 GB:FROM 2622776 GB:TO 2623336 GB:DIRECTION + GB:PRODUCT translation elongation factor P (EF-P) GB:PROTEIN_ID ABF09289.1 GB:DB_XREF GI:93355200 InterPro:IPR001059 InterPro:IPR011768 InterPro:IPR013185 LENGTH 186 SQ:AASEQ MKIAQELRVGNVFMIGSDPMVVQKAEYNKSGRNAAVVKMKYKNLLTEAPGESVFKADDKFEVVVLERRECTYSYFADPMYVFMDTEYNQYEVEKDSMGDSLNYLEDGMVVEVVFYNDKAISVEMPTTLVREIIYTEPAVKGDTSSGKVLKGAKINTGFELQVPLFCNIGDKIEIDTRTGEYRSRAN GT:EXON 1|1-186:0| SW:ID EFP_RALME SW:DE RecName: Full=Elongation factor P; Short=EF-P; SW:GN Name=efp; OrderedLocusNames=Rmet_2412; SW:KW Complete proteome; Cytoplasm; Elongation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->186|EFP_RALME|e-105|100.0|186/186| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003746|"GO:translation elongation factor activity"|Elongation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 150->169|PS01275|EFP|PDOC00981| BL:PDB:NREP 1 BL:PDB:REP 26->185|1uebA|2e-24|39.9|158/184| RP:PDB:NREP 1 RP:PDB:REP 1->124|2eifA|5e-27|21.3|122/133| RP:PFM:NREP 2 RP:PFM:REP 67->120|PF01132|3e-08|51.9|54/55|EFP| RP:PFM:REP 131->184|PF09285|5e-13|64.2|53/56|Elong-fact-P_C| HM:PFM:NREP 3 HM:PFM:REP 129->184|PF09285|1.4e-25|60.0|55/56|Elong-fact-P_C| HM:PFM:REP 67->120|PF01132|1.5e-20|44.4|54/55|EFP| HM:PFM:REP 4->60|PF08207|1.4e-19|33.3|57/58|EFP_N| GO:PFM:NREP 2 GO:PFM GO:0003746|"GO:translation elongation factor activity"|PF01132|IPR001059| GO:PFM GO:0006414|"GO:translational elongation"|PF01132|IPR001059| RP:SCP:NREP 3 RP:SCP:REP 1->63|1uebA1|4e-15|30.2|63/63|b.34.5.2| RP:SCP:REP 65->126|1uebA2|4e-19|32.8|61/63|b.40.4.5| RP:SCP:REP 128->185|1uebA3|8e-14|49.1|57/58|b.40.4.5| HM:SCP:REP 1->63|1uebA1|1.3e-15|44.4|63/0|b.34.5.2|1/1|Translation proteins SH3-like domain| HM:SCP:REP 64->126|1uebA2|8.8e-19|51.6|62/63|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 127->185|1uebA3|2e-16|60.3|58/58|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1125 OP:NHOMOORG 933 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111221--1111111211111111112222222211111111111111112221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121222212221111222221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111221111111111111111111111-11111111121111111111111111111112222211111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111111111111111111111111112111111111111222222222111111111111111111111111111111111111112222122212111111111111111211-1111111111122222222222222222-222222222222222122222222222222222222121222222222222112222222122221112111111111122121111111111111111111111111111111111111111111111111111122222222222222222222222222222111111111-1111111111111111-11111111111111111111111111111111 ------------111----------------------------------------------------------------------------------------1----2------------------------------------------------------1-----------1112F-11132221-221111-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 99.5 SQ:SECSTR EEEGGGccTTcEEEETTEEEEEEEEEEccccccccEEEEEEEEcccccEEEEEEETTcEEEEEcEEEEEEEEEEEETTEEEEEETTEcTccEEEEEcccccTTccTTcEEEEEEETTEEEEEEEEcEEEEEEEEccccccccccccccEEEEEETTccEEEEETTccTTcEEEEETTTTEEEEEc# DISOP:02AL 1-1,184-184,186-187| PSIPRED cccccccccccEEEEccEEEEEEEEEEEcccccccEEEEEEEEcccccEEEEEEccccEEEEEEEEEEEEEEEEEcccEEEEEcccccEEEEcHHHHHHHHHHcccccEEEEEEEccEEEEEEcccEEEEEEEEcccccccEEEccccccEEEEccccEEEcccccccccEEEEEcccccEEEEcc //