[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09290.1
DDBJ      :             glycoside hydrolase, family 3-like protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  614/915 : Eukaryota  71/199 : Viruses  0/175   --->[See Alignment]
c.1.8
:349 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->304 1y65A PDBj 9e-66 47.9 %
:RPS:PDB   5->320 3bmxA PDBj 3e-64 28.6 %
:RPS:SCOP  11->339 1tr9A  c.1.8.7 * 2e-75 42.2 %
:HMM:SCOP  9->333 1tr9A_ c.1.8.7 * 6.6e-85 41.1 %
:RPS:PFM   66->288 PF00933 * Glyco_hydro_3 2e-34 48.6 %
:HMM:PFM   65->287 PF00933 * Glyco_hydro_3 7.1e-45 33.0 212/227  
:BLT:SWISS 2->341 NAGZ_BORA1 e-117 63.3 %
:PROS 161->171|PS00639|THIOL_PROTEASE_HIS
:PROS 244->261|PS00775|GLYCOSYL_HYDROL_F3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09290.1 GT:GENE ABF09290.1 GT:PRODUCT glycoside hydrolase, family 3-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2623456..2624505) GB:FROM 2623456 GB:TO 2624505 GB:DIRECTION - GB:PRODUCT glycoside hydrolase, family 3-like protein GB:PROTEIN_ID ABF09290.1 GB:DB_XREF GI:93355201 InterPro:IPR000169 InterPro:IPR001764 LENGTH 349 SQ:AASEQ MNKKVSGKRPGPVVLDVVGKELTADDARRIAHPLTGGVILFARNFESRAQLVALTRAIREVRDDALICIDHEGGRVQRAKTDGFTHLPAMSRLGALWDRDVLAATKVAMACGYVLAAELRACDIDLSFTPVLDLDYGRSGVIGDRAFHADPRVVTMLANHLTHGLLLAGMANCGKHFPGHGYVEADSHVAIPVDERGLDEILSQDARPYDWMGPALASVMPAHVIYPTVDPSPAGFSRYWLQDILRTQLGFEGVIFSDDLSMEGASVAGTVTQAARAALEAGCDMVLICNHPDRADQLLNELDVSIGKASQRRIRKLFGRRKPLDWNKLQQEGEYRAALRLLKEHDLIA GT:EXON 1|1-349:0| BL:SWS:NREP 1 BL:SWS:REP 2->341|NAGZ_BORA1|e-117|63.3|338/350| PROS 161->171|PS00639|THIOL_PROTEASE_HIS|PDOC00126| PROS 244->261|PS00775|GLYCOSYL_HYDROL_F3|PDOC00621| BL:PDB:NREP 1 BL:PDB:REP 11->304|1y65A|9e-66|47.9|284/330| RP:PDB:NREP 1 RP:PDB:REP 5->320|3bmxA|3e-64|28.6|308/617| RP:PFM:NREP 1 RP:PFM:REP 66->288|PF00933|2e-34|48.6|210/226|Glyco_hydro_3| HM:PFM:NREP 1 HM:PFM:REP 65->287|PF00933|7.1e-45|33.0|212/227|Glyco_hydro_3| GO:PFM:NREP 2 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF00933|IPR001764| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00933|IPR001764| RP:SCP:NREP 1 RP:SCP:REP 11->339|1tr9A|2e-75|42.2|320/330|c.1.8.7| HM:SCP:REP 9->333|1tr9A_|6.6e-85|41.1|314/0|c.1.8.7|1/1|(Trans)glycosidases| OP:NHOMO 851 OP:NHOMOORG 689 OP:PATTERN -----------------1---------1-1-------------------------------1------ 121-31111111-111111-11--111111111111-11111-2-221-1--222--3--233222124211---111---12-----3311-1111--11211212211--------------122222222222-111------1111111-11111111111121111-111---1-11-121----2--1---------------111111---1-21321------121-----------------1----------------11-1----1111111-11---------2-----------------122---2221-111----------------21-211--2----11--1-----1-2-1--21-1111-----2122211111111111111-1111-11111111121-111123233211112121111111111--------1---1111------------1111111111111----1111111111112222111222111122222211111111111221111111111112111121111111111112121111111-11111----2---11111111-11111----------------1---111--12-1112111111111111111111111--11111------12111111111111111-1111111111111111111111211111111111111111111111111111-211111111111---11111111111111111111111112122111111111111-11111111111111111111122121121121111111111111111111111211-11111111222222222-1--------------------------2111222221-1 ---------------21112332232311111133323223221111222111211112111111----1--1-1-------1111---1-11-1--------111---------------------------------------------------------1----------1---11----12---1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 316 STR:RPRED 90.5 SQ:SECSTR ####ccEEccTTccccEEcccccHHHHHHHHHHcccEEEccGGGcccHHHHHHHHHHHHHHccccEEEEccccTTcccccHccccccccHHHHHHHccHHHTccccHHHHHHHHHHHHHHHHTccEEccccccccccTTcccGGGcccccHHHHHHHHHHHHHHHHHTTcEEEEEEETccTTccccTTTccccccccHHHHHHTTHHHHHHHHHTccEEEEcccccTTTccccGGGcHHHHccccccccccccEEEcccTTcHHHHTTccHHHHHHHHHHHTcccEEcccccccGGGTHHHHHHHHTcccHHHHHHHHHH############################# DISOP:02AL 1-2,343-350| PSIPRED cccccHHHccccEEEEcccccccHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccHHHHHHccHHHHHHHHccccEEEEEEEEccccccccccccHHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHHHHccccEEcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHcc //