[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09304.1
DDBJ      :             acyl carrier protein
Swiss-Prot:ACP_RALME    RecName: Full=Acyl carrier protein;         Short=ACP;

Homologs  Archaea  0/68 : Bacteria  727/915 : Eukaryota  153/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->72 2ehtA PDBj 2e-22 64.3 %
:RPS:PDB   1->76 3ejbA PDBj 1e-18 72.4 %
:RPS:SCOP  3->72 1f80D  a.28.1.1 * 3e-19 62.9 %
:HMM:SCOP  1->77 1klpA_ a.28.1.1 * 3.5e-21 44.2 %
:RPS:PFM   8->59 PF00550 * PP-binding 2e-05 51.0 %
:HMM:PFM   6->72 PF00550 * PP-binding 1.5e-18 39.4 66/67  
:BLT:SWISS 1->79 ACP_RALME 6e-40 100.0 %
:PROS 32->47|PS00012|PHOSPHOPANTETHEINE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09304.1 GT:GENE ABF09304.1 GT:PRODUCT acyl carrier protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2637618..2637857) GB:FROM 2637618 GB:TO 2637857 GB:DIRECTION - GB:PRODUCT acyl carrier protein GB:PROTEIN_ID ABF09304.1 GB:DB_XREF GI:93355215 InterPro:IPR003231 InterPro:IPR006162 InterPro:IPR006163 LENGTH 79 SQ:AASEQ MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEAEKITTVQQAIDYATAHVKA GT:EXON 1|1-79:0| SW:ID ACP_RALME SW:DE RecName: Full=Acyl carrier protein; Short=ACP; SW:GN Name=acpP; OrderedLocusNames=Rmet_2427; SW:KW Complete proteome; Cytoplasm; Fatty acid biosynthesis;Lipid synthesis; Phosphopantetheine. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|ACP_RALME|6e-40|100.0|79/79| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| PROS 32->47|PS00012|PHOSPHOPANTETHEINE|PDOC00012| BL:PDB:NREP 1 BL:PDB:REP 3->72|2ehtA|2e-22|64.3|70/77| RP:PDB:NREP 1 RP:PDB:REP 1->76|3ejbA|1e-18|72.4|76/78| RP:PFM:NREP 1 RP:PFM:REP 8->59|PF00550|2e-05|51.0|51/67|PP-binding| HM:PFM:NREP 1 HM:PFM:REP 6->72|PF00550|1.5e-18|39.4|66/67|PP-binding| GO:PFM:NREP 1 GO:PFM GO:0048037|"GO:cofactor binding"|PF00550|IPR006163| RP:SCP:NREP 1 RP:SCP:REP 3->72|1f80D|3e-19|62.9|70/74|a.28.1.1| HM:SCP:REP 1->77|1klpA_|3.5e-21|44.2|77/115|a.28.1.1|1/1|ACP-like| OP:NHOMO 1013 OP:NHOMOORG 880 OP:PATTERN -------------------------------------------------------------------- 1111----111---1---------------------1-111212--111-------1---11---121111-----------11111111111-1111-11111111111111111111111111111111111111111111111111211111111111111111-121111111111111111111112111111111111111111-1111111111--11---------111111111111111111111111111111111111111111---111----111----------------------------------11211222222212112112-----1--1211111111-1--11111-11111----11111111111111111111111111112-111111111111-2-1111111421111-11111111111111111111111111---1--------1111111111111111111121111111111211111111111111111111111111112111111111111111111111111111111111111111-1111111-111111111111121-1111111111111121111211111111111-111111111111111-11111111111-11111------11111111111111-11-11111111111111111111111122111111111111111111111111111111111111111111111111111111111111111111111111111111111111222211111111111211111111111-1111111111111111111111111111111111111--------111---1---------------------2212211111111 11----1-311--11111-111111-1111111-11-1111111-1-1111111111-1111211--112212121111112222211-1--1-1-11111--333-1712111121-111-1121-21151-111-11-2111111---1--1-1111--1111-1214211122111F1--2175681852-----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHccccTTTccTTccTTTTTcccTTHHHHHHHHHHHHTTccccHHHHHHcccHHHHHHHHHHcccc DISOP:02AL 78-80| PSIPRED cHHHHHHHHHHHHHHHcccHHHccccccHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHcc //