[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09321.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->37 PF02990 * EMP70 0.00039 35.7 28/521  
:HMM:PFM   33->73 PF04217 * DUF412 0.00066 32.5 40/143  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09321.1 GT:GENE ABF09321.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2655596..2655877 GB:FROM 2655596 GB:TO 2655877 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09321.1 GB:DB_XREF GI:93355232 LENGTH 93 SQ:AASEQ MNQEIAYLHPVKTARALVLVYLCFSVPIVAMGLFVAFIRYGDLPGITVFTALILNALIGFGLLWLGCKAYNWVAARFGGIEVHVRELTPEDRQ GT:EXON 1|1-93:0| TM:NTM 2 TM:REGION 15->37| TM:REGION 46->68| HM:PFM:NREP 2 HM:PFM:REP 10->37|PF02990|0.00039|35.7|28/521|EMP70| HM:PFM:REP 33->73|PF04217|0.00066|32.5|40/143|DUF412| OP:NHOMO 34 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111211111111111111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,86-86,88-94| PSIPRED ccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccc //