[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09326.1
DDBJ      :             Nicotinate phosphoribosyltransferase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  267/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
c.1.17d.41.2
:399 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->395 1yirA PDBj e-105 51.9 %
:RPS:PDB   12->398 2e5bA PDBj 8e-77 16.3 %
:RPS:SCOP  9->140 1vlpA1  d.41.2.2 * 2e-47 31.1 %
:RPS:SCOP  147->390 1ybeA1  c.1.17.2 * 9e-74 39.4 %
:HMM:SCOP  8->146 1ybeA2 d.41.2.2 * 1.7e-44 41.0 %
:HMM:SCOP  125->396 1ybeA1 c.1.17.2 * 2.1e-90 47.6 %
:RPS:PFM   171->377 PF04095 * NAPRTase 5e-21 44.7 %
:HMM:PFM   172->395 PF04095 * NAPRTase 3.1e-70 41.3 218/245  
:BLT:SWISS 8->399 PNCB_RALEH 0.0 86.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09326.1 GT:GENE ABF09326.1 GT:PRODUCT Nicotinate phosphoribosyltransferase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2660689..2661888) GB:FROM 2660689 GB:TO 2661888 GB:DIRECTION - GB:PRODUCT Nicotinate phosphoribosyltransferase GB:PROTEIN_ID ABF09326.1 GB:DB_XREF GI:93355237 InterPro:IPR006406 InterPro:IPR007229 LENGTH 399 SQ:AASEQ MPPSGLVMIIRSLLDTDLYKFTMMQVVLHHFPQAQVEYRFKCRNAGVDLTPYVDEIRSQITQLCQLRFTDDELNYLRGLRFIKSDFVEFLALFHLNEKYVQVLPSAKGNGEIEIIIKGPWLHTILFEIPLLAIVNEVYFRRTQPKPDLAEGRRRLQAKLELLAAPPYVDCVIADYGTRRRFSCDWQEEVLLSMRDAIGPQLAGTSNVHFARLHNMTPLGTMAHEYLQACQALGPRLRDSQVYALERWAHEYRGDLGIALSDTYGFDAFLRDFDLYFCKLFDGVRHDSGDPFEWGERMIAHYAANRVDPRGKTLIFSDALDIPKVIELYERFRGRCKLAFGVGTNLTNDLGYKPLQIVIKMVRCNGQPVAKLSDTPEKTMCDDPGYLSYLRQVFAVQAPA GT:EXON 1|1-399:0| BL:SWS:NREP 1 BL:SWS:REP 8->399|PNCB_RALEH|0.0|86.2|392/392| TM:NTM 1 TM:REGION 118->139| SEG 111->116|eieiii| BL:PDB:NREP 1 BL:PDB:REP 9->395|1yirA|e-105|51.9|376/390| RP:PDB:NREP 1 RP:PDB:REP 12->398|2e5bA|8e-77|16.3|374/466| RP:PFM:NREP 1 RP:PFM:REP 171->377|PF04095|5e-21|44.7|190/227|NAPRTase| HM:PFM:NREP 1 HM:PFM:REP 172->395|PF04095|3.1e-70|41.3|218/245|NAPRTase| RP:SCP:NREP 2 RP:SCP:REP 9->140|1vlpA1|2e-47|31.1|132/149|d.41.2.2| RP:SCP:REP 147->390|1ybeA1|9e-74|39.4|241/261|c.1.17.2| HM:SCP:REP 8->146|1ybeA2|1.7e-44|41.0|134/0|d.41.2.2|1/1|Nicotinate/Quinolinate PRTase N-terminal domain-like| HM:SCP:REP 125->396|1ybeA1|2.1e-90|47.6|254/0|c.1.17.2|1/1|Nicotinate/Quinolinate PRTase C-terminal domain-like| OP:NHOMO 385 OP:NHOMOORG 364 OP:PATTERN -------------------------------------------------1111--------------- 1---------------------------------------------------------------------------------------111---11---111-------1--------------------------------------------------------------------------------------------------------------------------------------------------1--1---------------------------------------------------------------------------------------------2------------------1------111111--1111-----1-11111111111-1111111111-111111111111111---1111111111---------------------------------------------------111111112111111111111111111111111--111--211221-2111-----1-1111111--------11------------------1------------------------------------111-------1--------------------------1--1111111111111111-111-1111111111111111111111111111111111111111111111111111-111111111111------------1---1----------------1111111111--22222212111121111-------------11111111-111111111---1111---1------------------------------------------------------- --------211---111111111111111111111111111111111111111111111111111111-11211111-1111111111-12-121-1111111122----------------------------------------------------1----1-------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 390 STR:RPRED 97.7 SQ:SECSTR ########cccGGGcccGGGGGGGGTccTTEETcEEEEEEEEccccccEEEcccHHHHHHHHTccccccHHHHHHHHHHccccHHHHHHHHHHHTTcccEEEEEccTTcccEEEEEEEccGGGTTHHHHTHHHHHTTHHHHHHTHHHHHHHHHHHHHHHHHHHccTTGGGcEEEccTTTcccHHHHHHHHHHHHHHHTTTccccccTHHHHHHHccccccccHHHHHTTcTTcHccGGGHHHHHHHHHHHTccccEEEEcccccHHHHHHTcccccTHccEEEEcccccHHHHHHHHHHHHHHHEEccTTEEEEEcccccHHHHHHHHHHHHHTGGEEEEEcHHHHTcccTTTTTEEEEEEEETTEEEEcccccccccEEEEcTTccEEEEcTTGGGG# DISOP:02AL 1-4,398-400| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHccccccEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHcccccEEEEEccccccccccccccEEEEEEEEccEEEEEEccccccccccccccccccHHcccccccc //