[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09334.1
DDBJ      :             nodulation ABC transporter NodI
Swiss-Prot:NODI_RALME   RecName: Full=Nod factor export ATP-binding protein I;         EC=3.6.3.-;AltName: Full=Nodulation ATP-binding protein I;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:303 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->272 3dhwC PDBj 3e-27 32.2 %
:RPS:PDB   4->223 3b5jA PDBj 1e-40 25.7 %
:RPS:SCOP  4->242 1b0uA  c.37.1.12 * 5e-41 27.6 %
:HMM:SCOP  7->217 1ii8.1 c.37.1.12 * 1.5e-72 40.7 %
:RPS:PFM   56->164 PF00005 * ABC_tran 1e-09 37.5 %
:HMM:PFM   44->164 PF00005 * ABC_tran 1.1e-22 33.0 115/118  
:BLT:SWISS 1->303 NODI_RALME e-168 100.0 %
:PROS 136->150|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09334.1 GT:GENE ABF09334.1 GT:PRODUCT nodulation ABC transporter NodI GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2667751..2668662 GB:FROM 2667751 GB:TO 2668662 GB:DIRECTION + GB:PRODUCT nodulation ABC transporter NodI GB:PROTEIN_ID ABF09334.1 GB:DB_XREF GI:93355245 InterPro:IPR001687 InterPro:IPR003439 InterPro:IPR003593 InterPro:IPR005978 LENGTH 303 SQ:AASEQ MTAILQMRNVRKLYGDHVVVDNLDLEVQPGQCFGLLGPNGAGKTTTLRMLLGLTTPASGTLMLCGEPIPQRAPQARMRVGVVPQFDNLDPDFSVIENLRIFGRYFGLSSAQIAERVPKLLEFARLESRADAQVRDLSGGMRRRLTVARALINDPDLLIMDEPTTGLDPQARHLIWERLKSLLSAGKTILLTTHFMEEAERLCNHLCVIDAGRKIAEGKPHELIDSEIGCDVVEVYGDELEPLRDTLTPLAERTEMRGETLFFYVREPAPLLAALHGKGGVRYLHRPANLEDVFLKLTGREMRD GT:EXON 1|1-303:0| SW:ID NODI_RALME SW:DE RecName: Full=Nod factor export ATP-binding protein I; EC=3.6.3.-;AltName: Full=Nodulation ATP-binding protein I; SW:GN Name=nodI; OrderedLocusNames=Rmet_2457; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Hydrolase; Membrane; Nodulation; Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->303|NODI_RALME|e-168|100.0|303/303| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009877|"GO:nodulation"|Nodulation| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 136->150|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 44->55|tttlrmllgltt| BL:PDB:NREP 1 BL:PDB:REP 4->272|3dhwC|3e-27|32.2|261/343| RP:PDB:NREP 1 RP:PDB:REP 4->223|3b5jA|1e-40|25.7|218/243| RP:PFM:NREP 1 RP:PFM:REP 56->164|PF00005|1e-09|37.5|104/123|ABC_tran| HM:PFM:NREP 1 HM:PFM:REP 44->164|PF00005|1.1e-22|33.0|115/118|ABC_tran| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->242|1b0uA|5e-41|27.6|239/258|c.37.1.12| HM:SCP:REP 7->217|1ii8.1|1.5e-72|40.7|209/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 50236 OP:NHOMOORG 1172 OP:PATTERN UUKCQPHMTSSPRMUOpGSRNRQazOShnZiaJBDCGAIFHFDUbRamMR**h9RfPXZQTJMFW187 SdyQ*gghootbbWbUWQP-PoCCd*QQQQQSvtrv****Z*f****mvtjS***SVlFF***i*v****kcedd*ddZS*hoC8B8CSSRP3QEJH--GJTMLLcKZTT8999999BBBBBBBIXSKUZPMTUZTpvu**KJK*f*jv*kjphoWXQJMIQHhidn***dJQFGFHHRHJFGjagUSnd9Xh*************************fpx**irxyzwvx**ajlnlmihjjkkjjiYfadaycca**ZQaUe**QR**eWTZgggikqprusowwuvtvruopsvqsubabaZbbbecbaa*pmcbcompqo*y*********l*ip***ajii*uksl*eqUL**kidfgnSdhZklMSZfMhaZZMINIIMhd***cTw****************-ru*lj*s***UB**************KMM**********VUVVVVVV*cfNQrc*66566444665687CC6898877797685LDHFEF***************z********q********DQ**w*qyqv******ZqnPSKOnaIKJJKJIWUSfuod**UbZ*pYrtfcqLgecUYdiXeefcf**Z*MMNSFMLMNLG8C9999A99JSFHHPOtpuQuZcMTLuSTVWUMRbURQTRVXYVXX5-EOWRP22-222****X*vz*******wz-*zyy*y***z***uvyvuu*****jjZnmkmmnnnomklolmk*qmmtttvT5************33IJCECDDOPROUN*q*ZXXYWXHNRNMROTfMOQOOGTJPUyd*y*w****y****o***GCDBEDDDCKiomzrrssrz*wwvVVWUTVUQSSFEFE65QSRRJKMM88677777*CT9798C-7CB9CD9JIG8BFAA8888ZloSRl*lpkEeQ 1222ieF-VK6GTbRHHGCFLPLXLWOGFADEELGGAIFGCFDBEBHGKSNNUPJHIEFHHHF9B59828C6BCAEE3EECB78AH36-IL8HE9EAB79889RNJ1UpWgSbXgabILFBKVKkkEnE**g4iQjJJKCaIHbREMFHIXFC*FVNMpGb*HmMbJxYc*RaWKEMHC*CEBGSxae*I*yIH****U ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 300-304| PSIPRED cccEEEEEEEEEEEccEEEEcccEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEcccccHHcHHHHHHHccEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEEEccEEEEEccHHHHHHHccccEEEEEEEccHHHHHHHHcccccEEEEEccEEEEEEccHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcc //