[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09348.1
DDBJ      :             aspartate semialdehyde dehydrogenase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  596/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:378 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->375 1t4bA PDBj e-141 68.7 %
:RPS:PDB   1->375 1brmC PDBj 2e-43 66.1 %
:RPS:SCOP  3->161 2gyyA1  c.2.1.3 * 1e-22 22.6 %
:RPS:SCOP  133->363 1brmA2  d.81.1.1 * 5e-81 67.6 %
:HMM:SCOP  1->146 1nwcA1 c.2.1.3 * 3.2e-56 47.3 %
:HMM:SCOP  133->363 1brmA2 d.81.1.1 * 2.9e-77 43.0 %
:RPS:PFM   3->121 PF01118 * Semialdhyde_dh 6e-07 35.4 %
:RPS:PFM   185->361 PF02774 * Semialdhyde_dhC 8e-15 42.9 %
:HMM:PFM   143->362 PF02774 * Semialdhyde_dhC 1e-53 47.2 178/184  
:HMM:PFM   3->121 PF01118 * Semialdhyde_dh 4.5e-27 34.2 114/121  
:BLT:SWISS 3->377 DHAS_PSEAE e-147 69.4 %
:PROS 270->284|PS01103|ASD
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09348.1 GT:GENE ABF09348.1 GT:PRODUCT aspartate semialdehyde dehydrogenase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2684226..2685362) GB:FROM 2684226 GB:TO 2685362 GB:DIRECTION - GB:PRODUCT aspartate semialdehyde dehydrogenase GB:PROTEIN_ID ABF09348.1 GB:DB_XREF GI:93355259 InterPro:IPR000319 InterPro:IPR000534 InterPro:IPR011534 InterPro:IPR012280 LENGTH 378 SQ:AASEQ MIVGLVGWRGMVGSVLMQRMQEEGDFDHFEPIFFSTSNAGGKAPAMAKNETTLKDANDIEALKKCDVVLTAQGGDYTNDVFPRLRAAGWNGYWIDAASSLRMKDDAIIVLDPVNMGVIKDALKKGVKNFIGGNCTVSCMLMGLGGLFEHDLVEWMTSMTYQAASGGGAQHMRELLTQFGTLNAAVKPLLDNPASAILEIDRQILSTQHGLSADETKQFGVPLAGNLIPWIDKDLGNGVSREEWKGGAETNKILGRGEGFLGATGASPIAVDGLCVRIGAMRCHSQALTIKLRKDVPLDEIEGMLAANNQWAKVVPNTREASMKDLTPAAVTGTLTIPVGRLRKMQMGGEYLSAFTVGDQLLWGAAEPLRRMLRILIEG GT:EXON 1|1-378:0| BL:SWS:NREP 1 BL:SWS:REP 3->377|DHAS_PSEAE|e-147|69.4|366/370| PROS 270->284|PS01103|ASD|PDOC00847| TM:NTM 1 TM:REGION 1->23| BL:PDB:NREP 1 BL:PDB:REP 3->375|1t4bA|e-141|68.7|361/367| RP:PDB:NREP 1 RP:PDB:REP 1->375|1brmC|2e-43|66.1|357/359| RP:PFM:NREP 2 RP:PFM:REP 3->121|PF01118|6e-07|35.4|113/120|Semialdhyde_dh| RP:PFM:REP 185->361|PF02774|8e-15|42.9|156/165|Semialdhyde_dhC| HM:PFM:NREP 2 HM:PFM:REP 143->362|PF02774|1e-53|47.2|178/184|Semialdhyde_dhC| HM:PFM:REP 3->121|PF01118|4.5e-27|34.2|114/121|Semialdhyde_dh| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01118|IPR000534| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01118|IPR000534| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF01118|IPR000534| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01118|IPR000534| GO:PFM GO:0005737|"GO:cytoplasm"|PF02774|IPR012280| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF02774|IPR012280| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF02774|IPR012280| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF02774|IPR012280| RP:SCP:NREP 2 RP:SCP:REP 3->161|2gyyA1|1e-22|22.6|146/150|c.2.1.3| RP:SCP:REP 133->363|1brmA2|5e-81|67.6|210/210|d.81.1.1| HM:SCP:REP 1->146|1nwcA1|3.2e-56|47.3|146/148|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 133->363|1brmA2|2.9e-77|43.0|221/0|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 655 OP:NHOMOORG 611 OP:PATTERN -------------------------------------------------1------------------ ----111111111111111-1111111111111111111111111-111-1-111111--1111-112121-111---1111-11---1111111------1--1-1--1---------------1---------------111--11-11111111-11-11111-11-11--1---111--11111---111222222221222222--11-12221111--1-111-11-1--------------------1-1111111--21111---1-1-11111-111-1----------------------------111----111-1-------1-1--11------1------1111-1--21----1------111-111-11--1111-1--1-11111111111-111111111111111-111111111111---1------1-----------1111111--------1--------1-----111-111111111111111111111111111111-111111111111111111111111111111111111111111111111111-1-1-1---11211212-2------1-11111--1-111111111111111111111111111211111111111111111111-1111-111111111111111111111111-111111111111111111122211111111111111111111111111111111111111111111111-----11111111111111111111111111111111111111111111111111111111--11111222222222222221111111---11111-1-----------------1----------------------------1------11- ------------------------------------------------------------------------------------------------------------1-------------------------------------------------1---------------------11--11----1-1121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 373 STR:RPRED 98.7 SQ:SECSTR cEEEEEcTTcHHHHHHHHHHHHHTGGGcEEEEEcccccTTcccccTTccccccccTTcHHHHHTccEEEEcccHHHHHHHHHHHHTTTcccEEEEcccTTTTcTTEEEEcHHHHHHHHHHHHHTTccEEEEccHHHHHHHHHHHHHHTTTcEEEEEEEEEEccTTTcHHHHHHHHHHHHHHHHTTHHHHHcccccHHHHHHHHHHHTTTHcccccTTTccccTTcccccTTccTTccccccccccHHHHHHHTTcccc####HHcccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHcTTcccccccHHHHHHHccHHHHTTcccccEEEEEEcTTcTTEEEEEEEEETTcccccHHHHHHHHHHHH# DISOP:02AL 41-41| PSIPRED cEEEEEEcccHHHHHHHHHHHcccccccEEEEEEEccccccEEEEEcccEEEEEEcccHHHHccccEEEEccccHHHHHHHHHHHHccccEEEEEccccccccccEEEEEccccHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEcccEEEEEEEEEEEEcccccHHHHHHHHHHcccccEEEEcccccccccccHHHHcccccEEEEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHHc //