[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09352.1
DDBJ      :             3-isopropylmalate dehydratase, large subunit
Swiss-Prot:LEUC_RALEJ   RecName: Full=3-isopropylmalate dehydratase large subunit;         EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase;         Short=IPMI;

Homologs  Archaea  60/68 : Bacteria  781/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
c.83.1
:469 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   106->460 1c97A PDBj 2e-27 30.4 %
:RPS:PDB   1->466 2b3yA PDBj e-141 23.4 %
:RPS:SCOP  1->466 2b3xA2  c.83.1.1 * e-137 23.4 %
:HMM:SCOP  1->468 2b3yA2 c.83.1.1 * 3.7e-170 43.1 %
:RPS:PFM   28->460 PF00330 * Aconitase 6e-57 37.3 %
:HMM:PFM   4->460 PF00330 * Aconitase 8.2e-180 48.4 455/465  
:BLT:SWISS 1->469 LEUC_RALEJ 0.0 91.7 %
:PROS 339->355|PS00450|ACONITASE_1
:PROS 402->415|PS01244|ACONITASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09352.1 GT:GENE ABF09352.1 GT:PRODUCT 3-isopropylmalate dehydratase, large subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2687720..2689129) GB:FROM 2687720 GB:TO 2689129 GB:DIRECTION - GB:PRODUCT 3-isopropylmalate dehydratase, large subunit GB:PROTEIN_ID ABF09352.1 GB:DB_XREF GI:93355263 InterPro:IPR001030 InterPro:IPR004430 LENGTH 469 SQ:AASEQ MAKTLYDKLWDDHTVHVEEDGTTLLYIDRHLLHEVTSPQAFEGLKLAERPVWRISANLAVSDHNVPTTDRSQGIADPISKLQVDTLDLNCDAYGITQFKMNDHRQGIVHVIGPEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLLGKKAKNMLIKVEGKLPRGCTAKDIVLAVIGKIGTAGGTGYTMEFAGSAIRDLTMEGRMTVCNMAIEAGARAGLVAVDDVTLEYVKNRPFAPQGVEWDQAVAYWRTLHSDAGAHFDKVVELRAEEVRPQVTWGTSPEMVISIEDRVPDPEKEKDSNKRNAMERALEYMGLQPNVPMESINIDKVFIGSCTNSRIEDMRAAAWVVQKLGRKVASNVKLAMVVPGSGLVKEQAEREGLDKIFKAAGFEWREPGCSMCLAMNADRLDPGERCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAIEGHFVDIRKLG GT:EXON 1|1-469:0| SW:ID LEUC_RALEJ SW:DE RecName: Full=3-isopropylmalate dehydratase large subunit; EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase; Short=IPMI; SW:GN Name=leuC; OrderedLocusNames=Reut_A2314; SW:KW 4Fe-4S; Amino-acid biosynthesis;Branched-chain amino acid biosynthesis; Complete proteome; Iron;Iron-sulfur; Leucine biosynthesis; Lyase; Metal-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->469|LEUC_RALEJ|0.0|91.7|469/469| GO:SWS:NREP 7 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0009098|"GO:leucine biosynthetic process"|Leucine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 339->355|PS00450|ACONITASE_1|PDOC00423| PROS 402->415|PS01244|ACONITASE_2|PDOC00423| BL:PDB:NREP 1 BL:PDB:REP 106->460|1c97A|2e-27|30.4|326/753| RP:PDB:NREP 1 RP:PDB:REP 1->466|2b3yA|e-141|23.4|461/888| RP:PFM:NREP 1 RP:PFM:REP 28->460|PF00330|6e-57|37.3|410/434|Aconitase| HM:PFM:NREP 1 HM:PFM:REP 4->460|PF00330|8.2e-180|48.4|455/465|Aconitase| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00330|IPR001030| RP:SCP:NREP 1 RP:SCP:REP 1->466|2b3xA2|e-137|23.4|461/629|c.83.1.1| HM:SCP:REP 1->468|2b3yA2|3.7e-170|43.1|464/0|c.83.1.1|1/1|Aconitase iron-sulfur domain| OP:NHOMO 2509 OP:NHOMOORG 1024 OP:PATTERN 11-2--2211211112-2222222311222432222222222222222323332231-1--3112-33 2322321222222213322-22111422222112221144221122211222212222--221323422222222222-111422222222212---1111213322222--------------122233322223333432224222222222222222222222222322222222222223333322122222222222222222212222222222222112222222312222222222222222222-------1------------111212-------222------------------------222222122-24-22111111121232221---2-21-2322222222221222222--2122322211111423334222222222222222222-22422522222122232232223232542323222222322222222222222221111111111--11111111111111111222522465252223223222222542222-232566751144522222323223332222242223333311232122321222122222-232233233221223232222222223-1211111112222222222342335443333333333333333333-1-4422-11--132322232222222222-2212221222222222225232222323232323332323223211122222-222222222222111411111111124322111213-1111211233333334335144443455433434444212122121222223333333333342222233332331121332222-------------------------------------12--2-222212 ----223-211-2246542555567754434444434444444444334654854455443444444434454455413444444444-46454465554444656-4244572115112-33135-213O2-214--213-112131113-14-113425923211422814222222k2221243474442243331 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 468 STR:RPRED 99.8 SQ:SECSTR ccHHHHHHHHTHHHHTTTTTcEEEEcccEEEEEHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccTTHHHHHHHHHHHHHHHHHHcTTEEEEEEcTTcccHHcEEEETTEEEEccEEEEccGGGGGGGGGTcEEEEccHHHHHHHHTTccEEEEcccEEEEEEEccccTTccHHHHHHHHHHHHHHHccTTcEEEEEcGGGTTccHHHHHHHHHTHHHHTccEEEccccHHHHHHHHHTTccHHHHHHHHHHTccccTTcGGcccccEEEEEEGGGcccEEEccccTTcEEEGGGHHHHHHHHHHcccGGGTTcEEEEEETTEEEEEETTcEEEEEEccHHHHTcHHHHHHHHHHHHTTccccTTcEEEEEccccHHHHHHHHHTccHHHHHHTTccccccccGGGGTccccccHHHHHEEEccccccTTcccTTccEEEccHHHHHHHHHHccccccTTT# DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHccccccccEEEEEEEEEEEccccHHHHHHHHHccccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccccccEEEEEcccccccccccccEEEcccHHHHHHHHHcccEEEccccEEEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEEcccHHcccHHHHHHHHHHHHHHccEEEEccccHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccEEEEEEHHHccEEccccccHHHEEEHHHHcccHHHHcccHHHHHHHHHHHHcccccccEEccEEEEEEEEEccccccHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHcccHHHHHHcccEEEccccHHHccccccccccccEEEEcccccccccccccccEEEccHHHHHHHHHccccccHHHcc //