[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09370.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->42 PF01917 * Arch_flagellin 3.5e-05 28.2 39/191  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09370.1 GT:GENE ABF09370.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2707687..2707821 GB:FROM 2707687 GB:TO 2707821 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09370.1 GB:DB_XREF GI:93355281 LENGTH 44 SQ:AASEQ MVKILIAFVVVAGACLYLLTKGGGEVSMAGESHSTESHAPAAQK GT:EXON 1|1-44:0| TM:NTM 1 TM:REGION 1->23| HM:PFM:NREP 1 HM:PFM:REP 4->42|PF01917|3.5e-05|28.2|39/191|Arch_flagellin| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 28-45| PSIPRED cHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccc //