[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09387.1
DDBJ      :             Lysine exporter protein (LYSE/YGGA)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  248/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->205 PF01810 * LysE 1e-07 28.5 %
:HMM:PFM   22->202 PF01810 * LysE 6.9e-15 22.2 180/192  
:BLT:SWISS 15->204 EAMB_SALTI 2e-21 29.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09387.1 GT:GENE ABF09387.1 GT:PRODUCT Lysine exporter protein (LYSE/YGGA) GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2725443..2726072 GB:FROM 2725443 GB:TO 2726072 GB:DIRECTION + GB:PRODUCT Lysine exporter protein (LYSE/YGGA) GB:PROTEIN_ID ABF09387.1 GB:DB_XREF GI:93355298 InterPro:IPR001123 LENGTH 209 SQ:AASEQ MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAVAASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLALALTAIWIAVAGQPH GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 15->204|EAMB_SALTI|2e-21|29.9|184/195| TM:NTM 6 TM:REGION 12->34| TM:REGION 48->70| TM:REGION 75->97| TM:REGION 123->145| TM:REGION 151->173| TM:REGION 185->205| RP:PFM:NREP 1 RP:PFM:REP 26->205|PF01810|1e-07|28.5|179/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 22->202|PF01810|6.9e-15|22.2|180/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 353 OP:NHOMOORG 250 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111-11----1-111---1----------1----------------------------------------------------------------------------------------------2------------------------------------------------1----------122------------------2---------12--1--211111111-11-1122----211---------------1-----------------------------1--11-111111222211222211122222-21312223-----1-1222-211111--1--31--------------11-------1--1---------------1----11-----------------------121-2-2211-1222211311121222222--------------1111-21111111111-11111-111111111111-111332121-11111111111111211-11111-211111111111--------------1121---------------223311-----1122122431333322211---------22231111123432------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,98-113,208-210| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccc //