[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09419.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->110 PF00038 * Filament 0.00018 15.8 57/312  
:BLT:SWISS 54->114 MYO5B_HUMAN 6e-04 32.8 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09419.1 GT:GENE ABF09419.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2768166..2768690) GB:FROM 2768166 GB:TO 2768690 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09419.1 GB:DB_XREF GI:93355330 LENGTH 174 SQ:AASEQ MNNELDGVTAWPTTRLGHLQGESDPGRDPGEGVWQNTIAAADHALEEASRIQRGVQQNLKLMQEVRTLRDELRRAHAEIDRYRGMHARVVVSMRQLEDEHSVEMSRLQTDNELLLVRHRVYKLLAEHYATAALRFDPAVFAEHRDRVLEHVLFQRRKGMSLTQIGVGDIAFLLL GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 54->114|MYO5B_HUMAN|6e-04|32.8|61/1849| COIL:NAA 48 COIL:NSEG 1 COIL:REGION 41->88| HM:PFM:NREP 1 HM:PFM:REP 54->110|PF00038|0.00018|15.8|57/312|Filament| OP:NHOMO 11 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3222---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,20-29| PSIPRED cccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEcc //