[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09424.1
DDBJ      :             proline hydroxylase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:277 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   38->240 2a1xA PDBj 6e-09 13.4 %
:RPS:SCOP  45->264 2fctA1  b.82.2.9 * 5e-08 9.7 %
:BLT:SWISS 24->115 Y1571_AERPE 8e-04 21.8 %
:BLT:SWISS 154->227 OGFD1_HUMAN 2e-07 34.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09424.1 GT:GENE ABF09424.1 GT:PRODUCT proline hydroxylase-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2772294..2773127 GB:FROM 2772294 GB:TO 2773127 GB:DIRECTION + GB:PRODUCT proline hydroxylase-like protein GB:PROTEIN_ID ABF09424.1 GB:DB_XREF GI:93355335 LENGTH 277 SQ:AASEQ MEQATQVVERPADGFENIKTIDVARLLREEHLLTNEFAQQRPFRYIVIDNFLHADQAERIYKSYPAIDEAWQNGNDVHTKGKWGTPDVEGTVAGEFYREVNSPEFRTLLGRITGIPQLLQDPDLQGAGLHQIRDGGFLSVHIDFNRLRGSNLDRRLNLLVYMNPGWKEEWGGCLELWDMEKKQMVSSVLPLLNRCVIFETNEISYHGHPVPVSSGGVTRKSLSVYYYTDGRDDVVADNHSTIYVNTQGAEGSAKLLKNGIAHSARKLIKKLGGDGNF GT:EXON 1|1-277:0| BL:SWS:NREP 2 BL:SWS:REP 24->115|Y1571_AERPE|8e-04|21.8|87/100| BL:SWS:REP 154->227|OGFD1_HUMAN|2e-07|34.2|73/542| RP:PDB:NREP 1 RP:PDB:REP 38->240|2a1xA|6e-09|13.4|194/253| RP:SCP:NREP 1 RP:SCP:REP 45->264|2fctA1|5e-08|9.7|207/304|b.82.2.9| OP:NHOMO 33 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------2---1---------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----11--12---------------------1-----------------------1----------1----------11--------------------------------------------------------------------1--11---------------------11-------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------9---------------------------------------------------------------------1-------------11----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 201 STR:RPRED 72.6 SQ:SECSTR #####################################HHHHHHcEEEETTcccHHHHHHHHHHHHHHHTTcccccccEEEccEEEcccEEEcccEEEccTTcHHHHHHHHcHHHHHHHHcEccEEEEEEEEEEEEcccccccGGGGccEEcGGGEEEEEEEcccccTTEEcTcEEEcTTGGGccccEEcccTTcEEEEcTT#EccEEEcccccccc#cEEEEEEEEEETTcEEcccTTcG##################################### DISOP:02AL 1-8,248-254,275-278| PSIPRED ccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHccHHHHHHcccHHHHHcccccHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccEEEEccccEEEEcccccccccccccEEEEEEEEEcccccHHHccEEEEEcccccccccEEEEcccEEEEEEcccccccccccEEcccccEEEEEEEEEEcccccHHHHHHHHHHccccccccHHHHHHHHcHHHHHHHHHHHHcccccc //