[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09437.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:305 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09437.1 GT:GENE ABF09437.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2783458..2784375) GB:FROM 2783458 GB:TO 2784375 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09437.1 GB:DB_XREF GI:93355348 LENGTH 305 SQ:AASEQ MGARVSEQAEGQEIPDIKRVEVSPEELAKFTDEEDFTGLSVDLMIEQGSWTCLTASLLPGETRKWDRDQAILGGLLVRFYKLASALLDQTCQHRRETTFVLGRLAIECMINIQYLVSTNSKAVYQAYVIDSLRHEKKLMDRIETNIASRSGVMLPIEARMLGSIQKSFDKSGVKPEEVTKQAAKPWKDVDLYQRADAVGLGEAYLGLFGGPSHNVHGSWQDLIEYHLHHDGEGFTPELAWHRPRPQVLFTLARIGVETLMAYLEHFAGDGAEGVISELQDLGDRIEIANRAHEAFLSARQSKETA GT:EXON 1|1-305:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13,170-172,174-176,298-298,300-306| PSIPRED ccccccHHcccccccccEEEEccHHHHHHHccHHcccccEEEEEEEcccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHcccccHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //