[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09454.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.11
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   71->104 2ebqA PDBj 2e-04 17.6 %
:RPS:SCOP  70->101 2c6aA1  g.41.11.1 * 3e-04 21.9 %
:HMM:PFM   74->92 PF05876 * Terminase_GpA 6.5e-05 31.6 19/557  
:HMM:PFM   92->99 PF00098 * zf-CCHC 0.00092 37.5 8/18  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09454.1 GT:GENE ABF09454.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2801771..2802088 GB:FROM 2801771 GB:TO 2802088 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09454.1 GB:DB_XREF GI:93355365 InterPro:IPR001876 LENGTH 105 SQ:AASEQ MKLLLRTPSLVHAAHCENVLRAAGIQAEVRNTWLAGAAGDIPLQESAPQVWILDDSTEADAWAVLNAAANPRPGPHWQCRHCGEWHEAQFAACWRCGQPQDQAAG GT:EXON 1|1-105:0| SEG 59->69|adawavlnaaa| RP:PDB:NREP 1 RP:PDB:REP 71->104|2ebqA|2e-04|17.6|34/47| HM:PFM:NREP 2 HM:PFM:REP 74->92|PF05876|6.5e-05|31.6|19/557|Terminase_GpA| HM:PFM:REP 92->99|PF00098|0.00092|37.5|8/18|zf-CCHC| RP:SCP:NREP 1 RP:SCP:REP 70->101|2c6aA1|3e-04|21.9|32/46|g.41.11.1| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-1111-1111111111111111-11111--111--1---1111-----------------------------------------------------------------------------------------1---1---------------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 35 STR:RPRED 33.3 SQ:SECSTR #####################################################################cccccccEEccccccEEcccccccccccccccccc# DISOP:02AL 1-1,101-106| PSIPRED ccEEEccccHHHHHHHHHHHHHcccEEEEEccHHHHHcccccHHHcccEEEEEcHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHcccccccccc //