[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09468.1
DDBJ      :             transcriptional regulator, DeoR family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  544/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.124.1
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->55 1bibA PDBj 8e-10 27.5 %
:RPS:PDB   81->254 3dlxA PDBj 9e-15 12.7 %
:RPS:SCOP  3->56 1lvaA4  a.4.5.35 * 6e-08 18.5 %
:RPS:SCOP  76->215 1poiB  c.124.1.3 * 3e-15 13.6 %
:HMM:SCOP  2->56 1stzA1 a.4.5.51 * 4.1e-11 45.5 %
:HMM:SCOP  76->239 1lk5A1 c.124.1.4 * 3.2e-30 36.1 %
:RPS:PFM   6->56 PF08220 * HTH_DeoR 6e-07 47.1 %
:RPS:PFM   80->235 PF00455 * DeoR 2e-23 35.9 %
:HMM:PFM   80->235 PF00455 * DeoR 3.7e-36 37.2 156/157  
:HMM:PFM   6->57 PF08220 * HTH_DeoR 6e-17 50.0 52/57  
:BLT:SWISS 1->235 SRLR_ECOLI 1e-23 29.6 %
:PROS 6->40|PS00894|HTH_DEOR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09468.1 GT:GENE ABF09468.1 GT:PRODUCT transcriptional regulator, DeoR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2817590..2818366 GB:FROM 2817590 GB:TO 2818366 GB:DIRECTION + GB:PRODUCT transcriptional regulator, DeoR family GB:PROTEIN_ID ABF09468.1 GB:DB_XREF GI:93355379 InterPro:IPR001034 InterPro:IPR013196 LENGTH 258 SQ:AASEQ MKAADRRRAILELVLSGEDANVERLTSNLGVSEATVRRDLTALAREGRIVRTYGGAAPLMQIGGHEPEASLEERKALQRDQKESIARMAATFVDDGDAVLLDSGTTAAALARMLAARSDLHVYTTNLLVVTALVGLPEVRVTLIGGDVRPSSMGTFGPLAQLALSRISVDKAFLGADGVVAGVGLCEASAEQAYLKECIIRQAAEIFVLADSTKLGRARQQHWTPLERGWTLVTDGDATADQLEPFRALKQVRVAVAN GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 1->235|SRLR_ECOLI|1e-23|29.6|230/257| PROS 6->40|PS00894|HTH_DEOR_1|PDOC00696| SEG 107->117|aaalarmlaar| SEG 175->184|gadgvvagvg| RP:PDB:NREP 2 RP:PDB:REP 5->55|1bibA|8e-10|27.5|51/294| RP:PDB:REP 81->254|3dlxA|9e-15|12.7|173/470| RP:PFM:NREP 2 RP:PFM:REP 6->56|PF08220|6e-07|47.1|51/56|HTH_DeoR| RP:PFM:REP 80->235|PF00455|2e-23|35.9|156/157|DeoR| HM:PFM:NREP 2 HM:PFM:REP 80->235|PF00455|3.7e-36|37.2|156/157|DeoR| HM:PFM:REP 6->57|PF08220|6e-17|50.0|52/57|HTH_DeoR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08220|IPR001034| GO:PFM GO:0005622|"GO:intracellular"|PF08220|IPR001034| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08220|IPR001034| RP:SCP:NREP 2 RP:SCP:REP 3->56|1lvaA4|6e-08|18.5|54/60|a.4.5.35| RP:SCP:REP 76->215|1poiB|3e-15|13.6|140/260|c.124.1.3| HM:SCP:REP 2->56|1stzA1|4.1e-11|45.5|55/87|a.4.5.51|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 76->239|1lk5A1|3.2e-30|36.1|144/150|c.124.1.4|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 1961 OP:NHOMOORG 549 OP:PATTERN ------------------------2--1---------------------------------------- 33--92123341-1-------2---5------222212221--28-1-12216361-4--2236658556311111-11---1--------1--------12--14-6-8--------------------------22211----------------------------1-------------3----11-31433333334243333365442434411113225555565A2222222222222224322331-1261-21144--871211--3423343333233333333333334444444444444433111333451165332334343412--234221-1-1121----1--1--42225211--12--------1-113---1311144444444445-111111121A--A665465B98542----2225145322111111113111---4-------------------------------1---111113554533333344673333134342232--1211-1111-1324-------311111111----1---2---12--1---1-------11-----1-----------------------------5382-1111223111111122211111111-------------7577564A98BABABAA-9BAA9A9A9A9CA9AABA5CBC46432B8CBCBCBBABBABBB9877AA982-766566556666---------------136333627123225773----------2133232433222222455----------333533333432551111111----------3-------------------------1-1------1--------41--13111--- -------------1------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 99.2 SQ:SECSTR TTEEEEEEEcTTccEEEEEEETTTTEEEEEETTEEEEEcTTcccGGGccccGGGccccccEEEEccccccTTTcTTHHHHHHHHHHHHHGGGccTTcEEEEcTTHHHHHGGGccTTccccEEEETTTEEEEcccccGGGcTTcccccEEEEEEEccHHHHHHHHHTTcccEEEEcccEEETTccEEccEETTTEEcccTccTTcEEEEEcccccGGGcccEEcccccccccccccEEEcccEEEEEETTTEEEEEE## DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHcccEEHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHcccccEEEEccHHHHHHHHcccccEEEEEccEEEccccEEEcHHHHHHHHcccccEEEEEccccccccccccccHHHHHHHHHHHHHcccEEEEEccccccccEEEEEEEHHHccEEEccccccHHHHHHHHHccccEEEEcc //