[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09472.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->78 PF09739 * DUF2044 0.0002 12.5 64/527  
:BLT:SWISS 23->84 FMRF_DROME 4e-04 33.9 %
:TM
:REPEAT 3|42->51|64->73|75->84

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09472.1 GT:GENE ABF09472.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2822098..2822355 GB:FROM 2822098 GB:TO 2822355 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09472.1 GB:DB_XREF GI:93355383 LENGTH 85 SQ:AASEQ MTNICRKLGALVIAMVVIPAPGLAGATEQAQQRRAGRDVRQDTRQGSRDTKQDCRAANQKSNSQCRQDKRDTKQQGRQTARDIKY GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 23->84|FMRF_DROME|4e-04|33.9|62/100| TM:NTM 1 TM:REGION 8->28| NREPEAT 1 REPEAT 3|42->51|64->73|75->84| HM:PFM:NREP 1 HM:PFM:REP 15->78|PF09739|0.0002|12.5|64/527|DUF2044| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------1---------1--1-------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,24-86| PSIPRED cHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccc //