[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09485.1
DDBJ      :             GatB/Yqey
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  485/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
a.182.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->147 1ng6A PDBj 1e-23 36.7 %
:RPS:PDB   1->118 3bmaE PDBj 3e-14 8.8 %
:RPS:SCOP  1->147 1ng6A  a.182.1.1 * 3e-41 36.7 %
:HMM:SCOP  1->147 1ng6A_ a.182.1.1 * 1.2e-45 46.9 %
:RPS:PFM   6->146 PF09424 * YqeY 3e-25 53.2 %
:HMM:PFM   4->146 PF09424 * YqeY 9.1e-59 53.8 143/143  
:BLT:SWISS 1->147 YQEY_BACSU 3e-23 36.7 %
:REPEAT 2|113->129|130->146
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09485.1 GT:GENE ABF09485.1 GT:PRODUCT GatB/Yqey GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2838582..2839031) GB:FROM 2838582 GB:TO 2839031 GB:DIRECTION - GB:PRODUCT GatB/Yqey GB:PROTEIN_ID ABF09485.1 GB:DB_XREF GI:93355396 InterPro:IPR003789 LENGTH 149 SQ:AASEQ MSLKARINDDMKAAMRAREAERLGTVRLLLAAIKQREVDERIELDDAGITAVIDKMIKQRKDSISQFEQAGRDDLVAKEKAELDVLVAYMPAQLSDAEVAAEVQKAVTESGAAGPQDMGKVMGLVKARLAGRADMTAVSALVKAALAPK GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 1->147|YQEY_BACSU|3e-23|36.7|147/148| NREPEAT 1 REPEAT 2|113->129|130->146| SEG 13->22|aamrareaer| BL:PDB:NREP 1 BL:PDB:REP 1->147|1ng6A|1e-23|36.7|147/148| RP:PDB:NREP 1 RP:PDB:REP 1->118|3bmaE|3e-14|8.8|114/390| RP:PFM:NREP 1 RP:PFM:REP 6->146|PF09424|3e-25|53.2|141/143|YqeY| HM:PFM:NREP 1 HM:PFM:REP 4->146|PF09424|9.1e-59|53.8|143/143|YqeY| RP:SCP:NREP 1 RP:SCP:REP 1->147|1ng6A|3e-41|36.7|147/148|a.182.1.1| HM:SCP:REP 1->147|1ng6A_|1.2e-45|46.9|147/148|a.182.1.1|1/1|GatB/YqeY motif| OP:NHOMO 497 OP:NHOMOORG 497 OP:PATTERN -------------------------------------------------------------------- 11---11-111-1----11-1---1-111111----11111--1---------11-------1-1-111--1--------11---1111111-111---11111111111---------------11111111111-111111111-11---------------------1--------------------111111111111111111111111111111111111111111--------------------111-11-1111111111111111-----------------------------------------------11111111111111111--1111-11--1--1-11-1--111111111--1-------1--1111111111111111111111111-11111111111-111111111111111-1-11111111111111111-11--111-----------------------------111111111111-11111111111111111-11111111111111111111111111111111111111111111-11-----111111111111-1111-11111-11111111111-1---------11-111111-1111-1111111111111111111111--11111--------------------------------------------------------------------------------------------1111-11111111-1---------------1111111111-11111-------------11111111111111111111111111111111111111--1-111111------------------------------------1111-11-11111 --------------1--11----------------------------------------------1-1----------1----------1-------------111----------------------------------------------------------------------11--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 98.7 SQ:SECSTR HHHHHHHHccccHHHHHHHHHHHHHcTTcTTHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHTHHHHHHHGTTccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHTTTccHHHHHHHHHHHcc## DISOP:02AL 148-150| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccc //