[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09494.1
DDBJ      :             Exodeoxyribonuclease VII small subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  141/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.7.13
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->84 1vp7A PDBj 6e-18 65.1 %
:RPS:SCOP  17->84 1vp7A  a.7.13.1 * 4e-14 60.3 %
:HMM:SCOP  14->90 1vp7B_ a.7.13.1 * 4.1e-17 36.4 %
:RPS:PFM   24->76 PF02609 * Exonuc_VII_S 3e-08 50.9 %
:HMM:PFM   24->76 PF02609 * Exonuc_VII_S 6.3e-23 45.3 53/53  
:BLT:SWISS 1->91 EX7S_RALSO 1e-23 61.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09494.1 GT:GENE ABF09494.1 GT:PRODUCT Exodeoxyribonuclease VII small subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2848140..2848448) GB:FROM 2848140 GB:TO 2848448 GB:DIRECTION - GB:PRODUCT Exodeoxyribonuclease VII small subunit GB:PROTEIN_ID ABF09494.1 GB:DB_XREF GI:93355405 InterPro:IPR003761 LENGTH 102 SQ:AASEQ MPRTTTAPVQPEDTPAASVPPASYEAAMAELETLVASMESGDLPLEASLAAYRRGAELVRFCQQSLERVAQQVKVLEGDALKPLAGESRTQNNADSNSADFE GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 1->91|EX7S_RALSO|1e-23|61.1|90/94| BL:PDB:NREP 1 BL:PDB:REP 21->84|1vp7A|6e-18|65.1|63/67| RP:PFM:NREP 1 RP:PFM:REP 24->76|PF02609|3e-08|50.9|53/53|Exonuc_VII_S| HM:PFM:NREP 1 HM:PFM:REP 24->76|PF02609|6.3e-23|45.3|53/53|Exonuc_VII_S| GO:PFM:NREP 3 GO:PFM GO:0006308|"GO:DNA catabolic process"|PF02609|IPR003761| GO:PFM GO:0008855|"GO:exodeoxyribonuclease VII activity"|PF02609|IPR003761| GO:PFM GO:0009318|"GO:exodeoxyribonuclease VII complex"|PF02609|IPR003761| RP:SCP:NREP 1 RP:SCP:REP 17->84|1vp7A|4e-14|60.3|68/68|a.7.13.1| HM:SCP:REP 14->90|1vp7B_|4.1e-17|36.4|77/0|a.7.13.1|1/1|XseB-like| OP:NHOMO 141 OP:NHOMOORG 141 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1111111111111111111-11111111111111-111111--11111111111111111111-11--------1----1------------------------------------------------------------------------------1---------11-111-1111111-11-1111111111111111111111-----1111111111111111-11111111-111111111111-------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 62.7 SQ:SECSTR ####################cccHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTc################## DISOP:02AL 1-23,82-103| PSIPRED cccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHc //