[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09522.1
DDBJ      :             peptide methionine sulfoxide reductase
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  781/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
d.58.28
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->154 2gt3A PDBj 7e-38 47.7 %
:RPS:PDB   5->177 3e0mC PDBj 6e-59 33.3 %
:RPS:SCOP  3->159 1ff3A  d.58.28.1 * 2e-61 45.5 %
:HMM:SCOP  1->172 1ff3A_ d.58.28.1 * 7.3e-71 54.4 %
:RPS:PFM   6->159 PF01625 * PMSR 3e-43 56.6 %
:HMM:PFM   7->160 PF01625 * PMSR 1.3e-66 55.9 152/156  
:BLT:SWISS 5->174 MSRA_POLSQ 7e-60 58.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09522.1 GT:GENE ABF09522.1 GT:PRODUCT peptide methionine sulfoxide reductase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2882831..2883373) GB:FROM 2882831 GB:TO 2883373 GB:DIRECTION - GB:PRODUCT peptide methionine sulfoxide reductase GB:PROTEIN_ID ABF09522.1 GB:DB_XREF GI:93355433 InterPro:IPR002569 LENGTH 180 SQ:AASEQ MDHGLEIATLGGGCFWCLEAVYQQVAGVRAVESGYTGGHVSQPTYHEVCAGDTGHAEVVRVTFDPSAINYREILEIFFSIHDPTQLNRQGNDVGTQYRSSIFTHSEAQRAVAEYVIGKLAAEHVYDAPIVTQVEPEQPYWPAEASHQNYYQEHPAQGYCAFVISPKLTKFRRDFSHRMRR GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 5->174|MSRA_POLSQ|7e-60|58.8|170/190| BL:PDB:NREP 1 BL:PDB:REP 4->154|2gt3A|7e-38|47.7|149/211| RP:PDB:NREP 1 RP:PDB:REP 5->177|3e0mC|6e-59|33.3|168/313| RP:PFM:NREP 1 RP:PFM:REP 6->159|PF01625|3e-43|56.6|152/156|PMSR| HM:PFM:NREP 1 HM:PFM:REP 7->160|PF01625|1.3e-66|55.9|152/156|PMSR| GO:PFM:NREP 3 GO:PFM GO:0016671|"GO:oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor"|PF01625|IPR002569| GO:PFM GO:0019538|"GO:protein metabolic process"|PF01625|IPR002569| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01625|IPR002569| RP:SCP:NREP 1 RP:SCP:REP 3->159|1ff3A|2e-61|45.5|156/211|d.58.28.1| HM:SCP:REP 1->172|1ff3A_|7.3e-71|54.4|171/0|d.58.28.1|1/1|Peptide methionine sulfoxide reductase| OP:NHOMO 1528 OP:NHOMOORG 997 OP:PATTERN ------11------1---------21113111211---1111-21111-1111-----1--1----11 132-111111111111111-11111211111111111111111111111111111111--11111111111-11111111111-----1111-111---11213241242--------------111111111111111111112-222211211222222221212223122222222222211111--111122222222222222222111122221132331111111633333323333333333333112122321-133112211111222211122222112222222222222222222222222112221111-11111111111-2--111-111111111----221----1------1221-22222-----133222122222211111111111-22122133222-2111223222331223122111112221111111113311111-----------------------------122241111122222222111122421111112231213-11111111121212112221111-111111111221111112112111111111122121111212111111111111111111111111-11211112121522433322223262222222223---2111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---211111223212122111-1--1111111111111112321211211233111111111222122222122222222233333221111111111111111221122--------111----1-1111-11---11111-1111-11------111 ----111-21111111111111111111111111111111111111111111111111-1--31111111111111111111111111-11111-11111111222-1E12232221111111121111461-2141111111111111-111111112211131113221-1221456c334235346167844222A ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 98.3 SQ:SECSTR ###TEEEEEEEcccHHHHHHHHHTcTTEEEEEEEEEccccccccTTTHHHcHHTcEEEEEEEEETTTccHHHHHHHHHHHcccccccEETTEEcGGGccEEEEccGGGHHHHHHHHHHHHHHHHHccccccEEEEcccEEEccTTTTTHHHHcTTTccccccGGGGGcccccGGGGcccH DISOP:02AL 1-3,176-178,180-181| PSIPRED cccccEEEEEEEEEHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHcccccEEEEEEEEEccccccHHHHHHHHHHHccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHHHHcc //