[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09530.1
DDBJ      :             protein of unknown function DUF883, ElaB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->72 PF05957 * DUF883 4e-07 40.8 %
:HMM:PFM   2->91 PF05957 * DUF883 2.6e-35 54.4 90/94  
:BLT:SWISS 24->72 ELAB_ECOLI 3e-05 32.7 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09530.1 GT:GENE ABF09530.1 GT:PRODUCT protein of unknown function DUF883, ElaB GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2891159..2891434 GB:FROM 2891159 GB:TO 2891434 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF883, ElaB GB:PROTEIN_ID ABF09530.1 GB:DB_XREF GI:93355441 InterPro:IPR010279 LENGTH 91 SQ:AASEQ MSDVKTVLSDAEELLKQAASTTGEKAAELRERGMGLLKQAKEKAQDLQDAVVTKSKAAARATDDYVHDHPWRAVGVAAGVGLLIGLLLNRK GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 24->72|ELAB_ECOLI|3e-05|32.7|49/101| COIL:NAA 59 COIL:NSEG 1 COIL:REGION 5->63| TM:NTM 1 TM:REGION 67->88| SEG 73->88|avgvaagvglliglll| RP:PFM:NREP 1 RP:PFM:REP 2->72|PF05957|4e-07|40.8|71/94|DUF883| HM:PFM:NREP 1 HM:PFM:REP 2->91|PF05957|2.6e-35|54.4|90/94|DUF883| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111--1111-------1--111---1-----------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-1------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,91-92| PSIPRED cHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc //