[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09531.1
DDBJ      :             putative transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->124 PF07332 * DUF1469 3e-05 37.4 %
:HMM:PFM   11->124 PF07332 * DUF1469 1.8e-26 30.7 114/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09531.1 GT:GENE ABF09531.1 GT:PRODUCT putative transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2891580..2891957 GB:FROM 2891580 GB:TO 2891957 GB:DIRECTION + GB:PRODUCT putative transmembrane protein GB:PROTEIN_ID ABF09531.1 GB:DB_XREF GI:93355442 LENGTH 125 SQ:AASEQ MSESPSPKFLESVRNLASSVVSMLQTRLELASVELAEERGRLMKVALLACFGLVFFSMALMTFTLLVAIVFWETYRWQALGIIILAYLACAAICLLLARRMVRRAPPLFEATLAELDKDREMLRR GT:EXON 1|1-125:0| TM:NTM 2 TM:REGION 46->68| TM:REGION 82->103| SEG 79->98|algiiilaylacaaicllla| RP:PFM:NREP 1 RP:PFM:REP 11->124|PF07332|3e-05|37.4|107/119|DUF1469| HM:PFM:NREP 1 HM:PFM:REP 11->124|PF07332|1.8e-26|30.7|114/121|DUF1469| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1111111111111111111111111----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,125-126| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcc //