[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09544.1
DDBJ      :             protein of unknown function DUF395, YeeE/YedE
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:371 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   88->130 PF04143 * DUF395 1.4e-14 37.2 43/43  
:HMM:PFM   313->351 PF04143 * DUF395 1.5e-09 39.5 38/43  
:BLT:SWISS 25->136,245->335 YEEE_ECOLI 2e-13 35.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09544.1 GT:GENE ABF09544.1 GT:PRODUCT protein of unknown function DUF395, YeeE/YedE GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2905138..2906253) GB:FROM 2905138 GB:TO 2906253 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF395, YeeE/YedE GB:PROTEIN_ID ABF09544.1 GB:DB_XREF GI:93355455 InterPro:IPR007272 LENGTH 371 SQ:AASEQ MPDIDIPALMRTVLLSTFVLTFLFGAILQRTHFCTMGAVSDIVNIGDWSRMRMWIMAIGVAMIGTGVLAWAGLIDPTKTIYTSARLGWLSTAVGGLMFGFGMVLASGCGSKTLVRIGAGNLKSLVVFVFLGLSAYMTLRGLFGVVRVSTVDTVAVTLPATQDLPSLIAHGTGLARGTLQLALGVVIGAVLVIWALLGNGFRTFDNLLGGLAVGLIIVGMWYVSGHIGYVSEDPNTLEELFVASNSGRMESLSFVAPYAYTLDWLMMFSDKSKVLTIGIVSVFGVIAGAAAYALVSRTFRWEGFGNAEDVANHMVGGILMGAGGVTALGCTVGQGLSGVSTLAVGSFIAFAAIIVGAVLAFKYQIWRLERMA GT:EXON 1|1-371:0| BL:SWS:NREP 1 BL:SWS:REP 25->136,245->335|YEEE_ECOLI|2e-13|35.5|195/100| TM:NTM 9 TM:REGION 8->30| TM:REGION 55->77| TM:REGION 87->109| TM:REGION 126->148| TM:REGION 172->194| TM:REGION 202->224| TM:REGION 275->297| TM:REGION 313->335| TM:REGION 339->361| SEG 12->24|tvllstfvltflf| SEG 144->156|vvrvstvdtvavt| SEG 178->196|lqlalgvvigavlviwall| SEG 206->218|llgglavgliivg| SEG 342->360|avgsfiafaaiivgavlaf| HM:PFM:NREP 2 HM:PFM:REP 88->130|PF04143|1.4e-14|37.2|43/43|DUF395| HM:PFM:REP 313->351|PF04143|1.5e-09|39.5|38/43|DUF395| OP:NHOMO 92 OP:NHOMOORG 75 OP:PATTERN ---------1---------------------------------------------------------- -----------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1--------------11-------------------3331-12-221-------------11-1-1------------------1---1-2-1--2-2-------------1------------------------------------------------------------------11111111132-----1------1----------------12------------------1--------------------------------------------------------------------------211-------------111-1--111-11111-111111-111111----------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccHHHHcccccccccEEEEEccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //