[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09548.1
DDBJ      :             TolB-like protein
Swiss-Prot:TOLB_RALME   RecName: Full=Protein tolB;Flags: Precursor;

Homologs  Archaea  6/68 : Bacteria  531/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
b.68.4b.68.7c.51.2
:446 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   50->445 2w8bA PDBj 1e-77 39.8 %
:RPS:PDB   58->445 1c5kA PDBj e-122 39.5 %
:RPS:SCOP  58->177 1c5kA2  c.51.2.1 * 1e-40 37.5 %
:RPS:SCOP  179->445 1c5kA1  b.68.4.1 * 8e-21 39.8 %
:HMM:SCOP  50->177 1crzA2 c.51.2.1 * 6.6e-37 42.2 %
:HMM:SCOP  169->443 1k32A2 b.68.7.1 * 1e-59 38.0 %
:RPS:PFM   47->145 PF04052 * TolB_N 1e-16 44.9 %
:RPS:PFM   246->403 PF10282 * Muc_lac_enz 7e-08 30.1 %
:HMM:PFM   210->240 PF07676 * PD40 2e-08 35.5 31/39  
:HMM:PFM   252->285 PF07676 * PD40 1.3e-10 38.2 34/39  
:HMM:PFM   293->329 PF07676 * PD40 2.9e-16 56.8 37/39  
:HMM:PFM   341->370 PF07676 * PD40 2.5e-08 33.3 30/39  
:HMM:PFM   386->413 PF07676 * PD40 2.6e-05 28.6 28/39  
:HMM:PFM   31->145 PF04052 * TolB_N 5.2e-35 41.2 114/120  
:HMM:PFM   241->258 PF02831 * gpW 0.00083 70.6 17/68  
:BLT:SWISS 1->446 TOLB_RALME 0.0 100.0 %
:REPEAT 3|284->327|328->370|371->412
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09548.1 GT:GENE ABF09548.1 GT:PRODUCT TolB-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2908503..2909843) GB:FROM 2908503 GB:TO 2909843 GB:DIRECTION - GB:PRODUCT TolB-like protein GB:PROTEIN_ID ABF09548.1 GB:DB_XREF GI:93355459 InterPro:IPR007195 InterPro:IPR011659 LENGTH 446 SQ:AASEQ MRKLWAPNWLSRRQNANPTRDQSRHALMAWLAAALMSAGAAHAQLNVEITGVGSNQFPVATANFQGEAQAPQNLTAIIRSDLTNSGRFRNVDPAGATVAESAQVDLGSWKAKGADAFVAGSVTPTSNGQYEVRFRLYDTAKGQSLGGLAFTVTQGQLRVTAHKIADYIYEKLLGERGVFATRLSYVSKVGNRYQLLISDSDGQNAQIALTSTEPIISPAWSPDGRRVAYVSFEAKKPVVYVHDLATGKRVVVSNQKGNNSAPSWSPDGQHLAVSLSRDGNTQIYQVNADGSGLRRLTRSSAIDTEPQFSPDGRSIYFTSDRGGAPQIYRMPASGEESGAAQRVTFKGSYNVSPRISPDGKYLAYISRSGGFRLQLQDLSNGDVTSLTDTTNDESPSFAANGKYILYATRVGGRSVLAAVSTDGRTKQVLSLQSGAVREPSWGPFMQ GT:EXON 1|1-446:0| SW:ID TOLB_RALME SW:DE RecName: Full=Protein tolB;Flags: Precursor; SW:GN Name=tolB; OrderedLocusNames=Rmet_2675; SW:KW Complete proteome; Periplasm; Protein transport; Signal; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->446|TOLB_RALME|0.0|100.0|446/446| GO:SWS:NREP 3 GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| NREPEAT 1 REPEAT 3|284->327|328->370|371->412| SEG 26->45|almawlaaalmsagaahaql| BL:PDB:NREP 1 BL:PDB:REP 50->445|2w8bA|1e-77|39.8|392/409| RP:PDB:NREP 1 RP:PDB:REP 58->445|1c5kA|e-122|39.5|385/397| RP:PFM:NREP 2 RP:PFM:REP 47->145|PF04052|1e-16|44.9|98/121|TolB_N| RP:PFM:REP 246->403|PF10282|7e-08|30.1|156/311|Muc_lac_enz| HM:PFM:NREP 7 HM:PFM:REP 210->240|PF07676|2e-08|35.5|31/39|PD40| HM:PFM:REP 252->285|PF07676|1.3e-10|38.2|34/39|PD40| HM:PFM:REP 293->329|PF07676|2.9e-16|56.8|37/39|PD40| HM:PFM:REP 341->370|PF07676|2.5e-08|33.3|30/39|PD40| HM:PFM:REP 386->413|PF07676|2.6e-05|28.6|28/39|PD40| HM:PFM:REP 31->145|PF04052|5.2e-35|41.2|114/120|TolB_N| HM:PFM:REP 241->258|PF02831|0.00083|70.6|17/68|gpW| GO:PFM:NREP 2 GO:PFM GO:0015031|"GO:protein transport"|PF04052|IPR007195| GO:PFM GO:0042597|"GO:periplasmic space"|PF04052|IPR007195| RP:SCP:NREP 2 RP:SCP:REP 58->177|1c5kA2|1e-40|37.5|120/128|c.51.2.1| RP:SCP:REP 179->445|1c5kA1|8e-21|39.8|264/269|b.68.4.1| HM:SCP:REP 50->177|1crzA2|6.6e-37|42.2|128/0|c.51.2.1|1/1|TolB, N-terminal domain| HM:SCP:REP 169->443|1k32A2|1e-59|38.0|258/281|b.68.7.1|1/1|Tricorn protease N-terminal domain| OP:NHOMO 742 OP:NHOMOORG 553 OP:PATTERN --------------------------------------------1-1--2222--------------- 28R-2----------------------------------1-111--1--------------2--111---------------------1112-2-----1---14211521111111111111111111111111133343---611------------------------------------1------1--------------------11-1----------------11----------------------------------------------------------------------------------------------------------------------2---------------------A111224111111-1111111111111111111111-1121111111112222222222121111211111111111111111111111131111-------1111111111111111-111224311111111111111111111111111111111111111121111111111112111111-------22111123111111111111121111131143444311111111111111111111111111111211311332312222232222222322222--11211------1111111111111111--111111111111111111111111111111111111111111111111111111111111111111112111111222111111111111111111111111111121111111111111111111111111111111111222221112222212112221111111-----11----------------------------------------------12- ---------------1---1---141--------------------1-----1------------------------------------------1------------------------------------------------------------------------------1--------1--121-32--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 395 STR:RPRED 88.6 SQ:SECSTR #################################################EcTTccE#EEEEcccEccccccccHHHHHHHHHHHTccEEEccGGGcccccTTTccHHHHTTTTcccEEEEEEEEcTTccEEEEEEEEEccTTEEEEEEEEEEcGGGHHHHHHHHHHHHHHHHHcccccTTcEEEEEEEccccEEEEEEETTccccEEEEEEcccEEEEEEcTTccEEEEEEcTTcccEEEEEETTTccEEEEEcccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTTccEEEcccccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTcTTTcccEEccccccEEEEEEEcTTccEEEEEEEETTEEEEEEETTTccEEEcccccccEEEEEcTTccEEEEEEEETTEEEEEEEETTcccEEEccccccEEEEEEEcccc# DISOP:02AL 1-2,12-23,94-100| PSIPRED ccccccccHHHHccccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEccccccccccHHHHHHHHHcccccccEEEcccccccccccccccHHHHHHccccEEEEEEEEEcccccEEEEEEEEEcccccEEEEEEEEcccccEEEEcccccccEEHHHcccccEEcccEEEEEcccccEEEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEcccccccEEEEEcccccEEEEEEcccccEEEEEEEccccEEEEEEccccccEEEEEcccccEEEEEEcccccEEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEEccccEEEEcccccccEEEEEcccccEEEEEEcccccEEEEEEEccccEEEEEEcccccEEEEEEccccc //