[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09557.1
DDBJ      :             putative signal peptide protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:186 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09557.1 GT:GENE ABF09557.1 GT:PRODUCT putative signal peptide protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2916540..2917100 GB:FROM 2916540 GB:TO 2917100 GB:DIRECTION + GB:PRODUCT putative signal peptide protein GB:PROTEIN_ID ABF09557.1 GB:DB_XREF GI:93355468 LENGTH 186 SQ:AASEQ MLNLRAHSGAALLAFLSTLLLMMASIGAAAAHLLFAGRSMTSQWLDREIAFRAAEVALLDAEADLIAAIAEVGGERLASWPTPGTCGTGAQRGLCMADGDMTAWMPWLEGNLPADLGIDAGTFTGITMPILPADVIGATTAPRYVIEPLEDRTGLTADAWPRFRITALGFGRDTGVRALLQTEFQP GT:EXON 1|1-186:0| SEG 10->25|aallaflstlllmmas| SEG 53->72|aaevalldaeadliaaiaev| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHEcccHHHHHHHHHHHccccccccccccccccccccccEEccccEEEEEEEccccccccccccccccccEEEEEccccccccccccEEEEEEccccccccccccccEEEEEEEEcccccEEEEEEEEEcc //