[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09579.1
DDBJ      :             putative transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   33->172 PF07273 * DUF1439 9e-17 39.9 %
:HMM:PFM   16->161 PF07273 * DUF1439 3.6e-16 20.1 144/177  
:BLT:SWISS 33->176 YCEB_SALTY 6e-06 29.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09579.1 GT:GENE ABF09579.1 GT:PRODUCT putative transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2939773..2940339) GB:FROM 2939773 GB:TO 2940339 GB:DIRECTION - GB:PRODUCT putative transmembrane protein GB:PROTEIN_ID ABF09579.1 GB:DB_XREF GI:93355490 LENGTH 188 SQ:AASEQ MIGTTRRRWLAAAGVAALATAGWLGGCSVFRNEYTFSQSQLQAALEKKFPFNKRYMELFDIQLANPQLMLDATRNRVTVAFDATIDNRLFFRQPLTGRFALDSALRYDQPTRSLVLQDPEVKQFDVQGLPSQFSRQLNALGGILSEQLLQGYPLYTFKPEQLRLAGTNVEPGTITVLPDGINVKINRP GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 33->176|YCEB_SALTY|6e-06|29.6|142/100| SEG 10->26|laaagvaalatagwlgg| RP:PFM:NREP 1 RP:PFM:REP 33->172|PF07273|9e-17|39.9|138/174|DUF1439| HM:PFM:NREP 1 HM:PFM:REP 16->161|PF07273|3.6e-16|20.1|144/177|DUF1439| OP:NHOMO 42 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111-11111112222--111--1111--11------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,187-189| PSIPRED ccccHHHHHHHHHcHHHHHHcccccccccccccEEEEHHHHHHHHHcccccEEEEEEEEEEEEcccEEEEcccccEEEEEEEEEEEcccccccccEEEEEEEEEEEEEcccccEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHccccccccEEEEEcccEEEEEccc //