[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09624.1
DDBJ      :             argininosuccinate lyase
Swiss-Prot:ARLY_RALME   RecName: Full=Argininosuccinate lyase;         Short=ASAL;         EC=4.3.2.1;AltName: Full=Arginosuccinase;

Homologs  Archaea  63/68 : Bacteria  790/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
a.127.1
:469 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->458 2e9fD PDBj e-106 50.7 %
:RPS:PDB   21->458 2e9fA PDBj e-123 48.8 %
:RPS:SCOP  23->458 1aosA  a.127.1.1 * e-110 40.5 %
:HMM:SCOP  11->470 1tj7A_ a.127.1.1 * 4.1e-148 39.9 %
:RPS:PFM   27->301 PF00206 * Lyase_1 1e-28 34.4 %
:HMM:PFM   15->308 PF00206 * Lyase_1 4.2e-79 34.1 293/312  
:BLT:SWISS 1->458 ARLY_RALME 0.0 100.0 %
:PROS 283->292|PS00163|FUMARATE_LYASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09624.1 GT:GENE ABF09624.1 GT:PRODUCT argininosuccinate lyase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2990235..2991644 GB:FROM 2990235 GB:TO 2991644 GB:DIRECTION + GB:PRODUCT argininosuccinate lyase GB:PROTEIN_ID ABF09624.1 GB:DB_XREF GI:93355535 InterPro:IPR000362 InterPro:IPR003031 InterPro:IPR009049 LENGTH 469 SQ:AASEQ MTSQLAKKGEAWSARFSEPMSDLVKRYTASVFFDKRLALFDIQGSLAHAAMLAKQGIIAEADRAEIERGMTQIRGEIESGAFEWKLDLEDVHLNIEARLTALVGDAGKRLHTGRSRNDQVATDIRLWLRSEIDSIVGLLGDLRGALLDLAEKNADTILPGFTHLQVAQPVTFGHHLMAYVEMFTRDAERMADCRRRVNRLPLGAAALAGTSYPIDREFVATQLGFDGVCRNSLDAVSDRDFAIEFLAAASLIMTHVSRFSEELVIWMSPRVGFIDIADRFCTGSSIMPQKKNPDVPELARGKTGRVYGHLTGLLTLMKGQPLAYNKDNQEDKEPLFDTVDTVVDTLRIFADMVPGISVKPDNMRAAALQGYATATDLADYLVKRGLPFRDAHEAVAHAVRACDDRHCDLADLTVEQLREVSGLGDKASLIGDDVHSVLTLEGSVASRNHIGGTAPDQVRAAIAAARKAL GT:EXON 1|1-469:0| SW:ID ARLY_RALME SW:DE RecName: Full=Argininosuccinate lyase; Short=ASAL; EC=4.3.2.1;AltName: Full=Arginosuccinase; SW:GN Name=argH; OrderedLocusNames=Rmet_2751; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; Complete proteome;Cytoplasm; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->458|ARLY_RALME|0.0|100.0|458/469| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 283->292|PS00163|FUMARATE_LYASES|PDOC00147| SEG 137->150|gllgdlrgalldla| SEG 459->468|raaiaaarka| BL:PDB:NREP 1 BL:PDB:REP 23->458|2e9fD|e-106|50.7|430/449| RP:PDB:NREP 1 RP:PDB:REP 21->458|2e9fA|e-123|48.8|432/449| RP:PFM:NREP 1 RP:PFM:REP 27->301|PF00206|1e-28|34.4|270/302|Lyase_1| HM:PFM:NREP 1 HM:PFM:REP 15->308|PF00206|4.2e-79|34.1|293/312|Lyase_1| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00206|IPR000362| RP:SCP:NREP 1 RP:SCP:REP 23->458|1aosA|e-110|40.5|420/434|a.127.1.1| HM:SCP:REP 11->470|1tj7A_|4.1e-148|39.9|454/0|a.127.1.1|1/1|L-aspartase-like| OP:NHOMO 1537 OP:NHOMOORG 1026 OP:PATTERN --12-13333322333-111111111111111112221122121222211122212111112111-11 1111122122222112211-11111211111111111144222212322112222123--223121132211111111--11121121111111---111-2-1111111---------------11111111121111112221212222221222222212221222111212222222222111111-2336666665645666662244436652124212222222522222222222222221222111-11211-1-332233-2-1111112221-11211122112211211111111111111222111222221-1211111111111111111-1112-3112333211122222212--1211111111--1-13111111111111111111112-1122131272111221221112223411112122121111111111111111111---11111---------------------11111112212322223122221112444442231241312111112111133231122111111211111111122-1111121122111112112211122122122111212222211111111111211111111111111111111112111111111111---112111111111211111111111111-1111211111111111111212231111111111111111111111111111-111111111111--11-----111111112111111111111111111111111131111111211111111111--------221111111111111222222222222221111221111--------1----------------------------11--12-11111 ------1-----1111211111111111111111111111111111111113243311111111111111111111111112111111-11121111111111111-13-2131123111111111-217B4-413---111111---111111152-212-121112112--11111181111131221111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 458 STR:RPRED 97.7 SQ:SECSTR EEETTEEEEEccccccccHHccHHHHHHccHHHHGGGHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHTcccccGGGccHHHHHHHHHHHHHcTTHHHHTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTcEEEEEETTEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcEEcTTccccccccccccHHHHHHHTTccEEcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTTccEEccGGGcEEcccccccEEcHHHHHHHHTHHHHHHHHHHHHHHHTTccccccGGGGGGHHHHHHHHHHHHHHHHHHHHHGGGcEEcHHHHHHHHccccTTHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHTTccGGGccHHHHHHHcTTccHcTTccGGGGGGGcHHHHTTccccTTcccHHHH########### DISOP:02AL 1-12| PSIPRED cccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHHHcc //