[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09633.1
DDBJ      :             4Fe-4S ferredoxin, iron-sulfur binding
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  439/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->179 1kqfB PDBj 2e-15 33.5 %
:RPS:PDB   56->123 1bc6A PDBj 1e-08 35.5 %
:RPS:SCOP  1->180 1ti2B2  d.58.1.5 * 6e-36 26.1 %
:HMM:SCOP  1->181 1q16B_ d.58.1.5 * 7.3e-50 43.4 %
:RPS:PFM   73->133 PF00160 * Pro_isomerase 9e-04 31.0 %
:HMM:PFM   9->24 PF00037 * Fer4 2e-05 50.0 16/24  
:HMM:PFM   83->103 PF00037 * Fer4 1.5e-10 52.4 21/24  
:BLT:SWISS 2->193 FDHB_WOLSU 4e-80 67.2 %
:PROS 88->99|PS00198|4FE4S_FER_1
:REPEAT 2|43->69|78->99
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09633.1 GT:GENE ABF09633.1 GT:PRODUCT 4Fe-4S ferredoxin, iron-sulfur binding GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3000383..3001063) GB:FROM 3000383 GB:TO 3001063 GB:DIRECTION - GB:PRODUCT 4Fe-4S ferredoxin, iron-sulfur binding GB:PROTEIN_ID ABF09633.1 GB:DB_XREF GI:93355544 InterPro:IPR000813 InterPro:IPR001450 LENGTH 226 SQ:AASEQ MARMKFICDAERCIECNSCVTACKNEHEVPWGVNRRRVVTVNDGVVGAEKSISVACMHCSDAPCMAVCPVDCFYRTEDGVVLHDKDVCIGCGYCSYACPFGAPQFPSEGTFGVRGKMDKCTFCNGGPEANGSEAEFEKYGRNRLAEGKLPLCAEMCSTKALLGGDGDVIADILRNRVIKRGKGGDVFGWGTAYGGVKAQPAAGTPPAAPGAAPTAPAAPASEGSAS GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 2->193|FDHB_WOLSU|4e-80|67.2|192/200| PROS 88->99|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|43->69|78->99| SEG 200->220|paagtppaapgaaptapaapa| BL:PDB:NREP 1 BL:PDB:REP 2->179|1kqfB|2e-15|33.5|155/289| RP:PDB:NREP 1 RP:PDB:REP 56->123|1bc6A|1e-08|35.5|62/77| RP:PFM:NREP 1 RP:PFM:REP 73->133|PF00160|9e-04|31.0|58/151|Pro_isomerase| HM:PFM:NREP 2 HM:PFM:REP 9->24|PF00037|2e-05|50.0|16/24|Fer4| HM:PFM:REP 83->103|PF00037|1.5e-10|52.4|21/24|Fer4| GO:PFM:NREP 2 GO:PFM GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|PF00160|IPR002130| GO:PFM GO:0006457|"GO:protein folding"|PF00160|IPR002130| RP:SCP:NREP 1 RP:SCP:REP 1->180|1ti2B2|6e-36|26.1|161/195|d.58.1.5| HM:SCP:REP 1->181|1q16B_|7.3e-50|43.4|159/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2116 OP:NHOMOORG 496 OP:PATTERN 11121222333333324-4464473113-1-21-433333333-1--13-21212115261---4--- -7A111-------1-1111-1---1111111-12221-111---1-211-----11------11-11-31---------7dS323111------------1------11----------------2243333332344411222-4----------------------------------------21---------------------1--------------1------1-1111111111111111111--------1---11-1-------------------------------------------------------133-1----------1311---------9--13ji2345-489-112---1631-----11--11--2-2-31------------1-2232222411--------1-1-2211-1-211-1--21211111111211--7-4-------------------------------111-122-11112111222222222222-121222211111123-332214212122-1-13----------7331584578957866B178786692-BAAA343427422112211-2-------2B3221174---1-----45886-5E998687BA7I7---1642------95B898-EEEDEDCCEE-EEDFECCEDEEDEDEEDD98888421BEDEEFFFFFFEDFDEE68B9CCCD--555555545555-------------1--1-444444133232114----------2-11111-1--11113-------------2333111114422311------------123---11---------------------------------------21-------121 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 79.2 SQ:SECSTR ccEEEEccGGGGccccccccTTcccTTccccTTTccccccccccHHHHHHHHHHHTTTccccccTTTcTTccEEEcccccEEEcTTTccccccHHHHcGGGccEETTTccGGGccHHHHHHHHHTTccccccccccTTHHHHTTcccGGGGHHHHcTTccEEEEEHHHHHHHHHHHHHH############################################### DISOP:02AL 1-1,200-214,216-227| PSIPRED ccEEEEEEEHHHcccccHHHHHHHHHHcccccccccEEEEEccccccccEEEEEcccccccccccEEcccccEEEcccccccccHHHcccccccHHccccccEEEccccccccccEEEEcccccccccccccccccccccHHHHHccccccHHHHcccccEEEEcHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc //