[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09646.1
DDBJ      :             condensin subunit ScpA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  451/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.1.15
:301 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  56->181 1bhwA  c.1.15.3 * 2e-13 14.9 %
:RPS:SCOP  228->296 1w1wE  a.4.5.57 * 3e-12 15.6 %
:RPS:PFM   81->295 PF02616 * ScpA_ScpB 3e-23 44.0 %
:HMM:PFM   81->296 PF02616 * ScpA_ScpB 3.4e-38 32.5 209/242  
:BLT:SWISS 40->295 SCPA_XYLFA 3e-60 48.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09646.1 GT:GENE ABF09646.1 GT:PRODUCT condensin subunit ScpA GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3020383..3021288 GB:FROM 3020383 GB:TO 3021288 GB:DIRECTION + GB:PRODUCT condensin subunit ScpA GB:PROTEIN_ID ABF09646.1 GB:DB_XREF GI:93355557 InterPro:IPR003768 LENGTH 301 SQ:AASEQ MHPSDPQEQAAQEKLSLPVELPSVAGAGSATSAADMVDGLAFARLYGEPLFKLPQDLYIPPDALEVFLEAFEGPLDLLLYLIRKQNFNVLDIPMAQVTRQYLSYIEQIRKRNLELAAEYLLMAAMLIEIKSRMLLPVKKADSDEEAEDPRAELVRRLLEYEQMKLAAQRLDTVPQLGRDFLRSQVFIEQSLAPRFPDVETLDLQSAWADVLRRAKLNQHHKISREELSVREHMSQILRRLQHARFMEFSELFEDAIRSGKGVPVVVVNFIAMLELSRESLVEITQAEPFAPIYVRLAYTPA GT:EXON 1|1-301:0| BL:SWS:NREP 1 BL:SWS:REP 40->295|SCPA_XYLFA|3e-60|48.4|252/302| SEG 25->34|agagsatsaa| SEG 113->126|lelaaeyllmaaml| RP:PFM:NREP 1 RP:PFM:REP 81->295|PF02616|3e-23|44.0|209/220|ScpA_ScpB| HM:PFM:NREP 1 HM:PFM:REP 81->296|PF02616|3.4e-38|32.5|209/242|ScpA_ScpB| RP:SCP:NREP 2 RP:SCP:REP 56->181|1bhwA|2e-13|14.9|121/392|c.1.15.3| RP:SCP:REP 228->296|1w1wE|3e-12|15.6|64/70|a.4.5.57| OP:NHOMO 453 OP:NHOMOORG 452 OP:PATTERN -------------------------------------------------------------------- 111-1--111111-1--11-1-111-111111-111---------------11-1-------------------------11-----------------------11-1---------------111111111-11-11---------------------------------------------------1111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111----1-------11111111111111-----------11111111111--1111-11-1--111-1111---111------------11111111-111111111111---1-----11--1111111111111111-1--111111---------1------1------------------------------1----1111111111111111111111111111111111111111111111111111111111111111111111111-1-----------111111111111111---------------------------1111-111-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111------------------------11111111111111------1111--------11-------11-1-1-111---------1--1111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15,138-145,300-302| PSIPRED cccccHHHHHHHccccccEEccccccccccccHHHHHHHccEEEEcccccccccHHHccccccEEEEccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHcccccccHHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHHHHccccEEHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEccccc //