[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09655.1
DDBJ      :             periplasmic binding protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  458/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->291 1n2zA PDBj 5e-36 36.2 %
:RPS:PDB   24->291 3eiwA PDBj 3e-47 19.3 %
:RPS:SCOP  40->292 1n2zA  c.92.2.2 * 4e-64 35.3 %
:HMM:SCOP  14->291 2chuA1 c.92.2.4 * 1.4e-64 33.8 %
:RPS:PFM   43->269 PF01497 * Peripla_BP_2 2e-25 36.0 %
:HMM:PFM   43->271 PF01497 * Peripla_BP_2 6.4e-35 25.0 228/238  
:HMM:PFM   1->47 PF07996 * T4SS 0.00015 31.9 47/217  
:BLT:SWISS 39->297 BTUF_VIBCM 6e-55 39.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09655.1 GT:GENE ABF09655.1 GT:PRODUCT periplasmic binding protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3029385..3030287 GB:FROM 3029385 GB:TO 3030287 GB:DIRECTION + GB:PRODUCT periplasmic binding protein GB:PROTEIN_ID ABF09655.1 GB:DB_XREF GI:93355566 InterPro:IPR002491 LENGTH 300 SQ:AASEQ MKAFYVASAASALLIAAMPAHAAVSVVDDAGETVTLAQPARRIVSLAPHVTELIFAAGGGDRIVGTVSYSDYPPQARDIPRVGDNKALDLERIAALKPDLIVVWRHGNAQKQTDRLRALGMPLFFSEPRKLDGIADNLEKLGTLMGTTPVAHRAATDFRQQVSTLRKTYAGRPPVTVFYQVWQQPLMTLNGEHMVSDLLALCGGRNLFGKEAALVPTVSVEAVVAGNPEVMLTAGMGATRSDKPLADFAMWEKWKQVTAVARNNLFVIDGDLVNRAGPRVAQGAAEICKDLDVARSRRPG GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 39->297|BTUF_VIBCM|6e-55|39.7|252/276| SEG 7->23|asaasalliaampahaa| BL:PDB:NREP 1 BL:PDB:REP 40->291|1n2zA|5e-36|36.2|240/245| RP:PDB:NREP 1 RP:PDB:REP 24->291|3eiwA|3e-47|19.3|264/292| RP:PFM:NREP 1 RP:PFM:REP 43->269|PF01497|2e-25|36.0|222/235|Peripla_BP_2| HM:PFM:NREP 2 HM:PFM:REP 43->271|PF01497|6.4e-35|25.0|228/238|Peripla_BP_2| HM:PFM:REP 1->47|PF07996|0.00015|31.9|47/217|T4SS| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 40->292|1n2zA|4e-64|35.3|241/245|c.92.2.2| HM:SCP:REP 14->291|2chuA1|1.4e-64|33.8|275/0|c.92.2.4|1/1|"Helical backbone" metal receptor| OP:NHOMO 699 OP:NHOMOORG 490 OP:PATTERN 22---11--------1-1---11-1112322-------1----1-32661----11111311------ 11--1--1111----------1---1----------2322-11-----1-11--------22-11-21222-----------2----------------1-111-21141---------------111111111-1322222133--------1---------1-11211-------------3433211-11122222112-2221122311212222223---22222131111111111111111111111----------------------------------------------------------------------11-11111111212----1111111--3---2112---111-211-11-21----1--1--112----111111------------11111123111-111211-11-1-1----111----11---------------1-------------------------------1----222211111111111111111111111122223--222231--312211112121211---------1222-2311111111111----1-----111122141-1--11111----------1------2211111-12-1111111311121122231---1111------211121-1222122211-211122212122211111111113112111111111111111121-21111--122222222222--------------1113----1------1-----11-1---11122223112222212------------11--12222222211-----------------1221111--------1---------------------------1121113111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 91.3 SQ:SECSTR #######################EEEEETTEEEEEEETTcccEEEccHHHHHHHHHTTccccEEccTTcHHHHHHHcccEEccccccccHHHHHHTcccEEEEETTTTTGTTHHHHHHHccEEEEcTTccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHccccTTccEEEEEETTEEEEccTTcHHHHHHHHTTccccccHHETTEEEEcHHHHHHHcccEEEEEEGGGccccHHHHHHHHcHHHHTcHHHHTTcEEEEEHHHHTTTccHHHHHHHHHHHHHHHHHcc### DISOP:02AL 1-1,297-301| PSIPRED cccEEEccccHHHHHHHcccccEEEEEEccccEEEEcccccEEEEEccHHHHHHHHccccccEEEEEccccccHHHHccccccccccccHHHHHHccccEEEEEccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEcccccHHHHHHHHcccccccccccccccccHHHHHHHcccEEEEEcccccccHHHHHHHHHcccHHccHHHHcccEEEEcHHHHccccHHHHHHHHHHHHHHHHHHccccc //