[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09664.1
DDBJ      :             protein of unknown function DUF710
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.244.1
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->98 1w2eB PDBj 5e-05 37.9 %
:RPS:SCOP  6->98 1t3uA  d.244.1.1 * 9e-13 30.3 %
:HMM:SCOP  5->100 1t3uA_ d.244.1.1 * 1.3e-18 33.7 %
:HMM:PFM   5->95 PF05164 * ZapA 6.9e-22 33.7 89/89  
:BLT:SWISS 35->105 ZAPA_PSEAE 2e-08 40.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09664.1 GT:GENE ABF09664.1 GT:PRODUCT protein of unknown function DUF710 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3038097..3038420 GB:FROM 3038097 GB:TO 3038420 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF710 GB:PROTEIN_ID ABF09664.1 GB:DB_XREF GI:93355575 InterPro:IPR007838 LENGTH 107 SQ:AASEQ MSNKQVEVNIAGQPYRFAIAPDNEAALLEAVALVDDKMNKLKGTVAAKGVERVAVMAAISIASDLLAMRRKQEEEGAIPVDAVRARIRELNERADEALRQYAHVGTR GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 35->105|ZAPA_PSEAE|2e-08|40.3|67/100| TM:NTM 1 TM:REGION 47->68| SEG 24->34|eaalleavalv| BL:PDB:NREP 1 BL:PDB:REP 36->98|1w2eB|5e-05|37.9|58/89| HM:PFM:NREP 1 HM:PFM:REP 5->95|PF05164|6.9e-22|33.7|89/89|ZapA| RP:SCP:NREP 1 RP:SCP:REP 6->98|1t3uA|9e-13|30.3|89/92|d.244.1.1| HM:SCP:REP 5->100|1t3uA_|1.3e-18|33.7|89/92|d.244.1.1|1/1|Cell division protein ZapA-like| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 54.2 SQ:SECSTR ###################################HHHHHHHHHcccccHHHHHH#HHHHHHHHHHHHHHHHHHHHH####HHHHHHHHHHHHHHHHH######### DISOP:02AL 1-3,71-76,103-108| PSIPRED ccccEEEEEEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcHHHHccc //