[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09668.1
DDBJ      :             Enoyl-CoA hydratase/isomerase
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  606/915 : Eukaryota  165/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->258 3h81B PDBj 9e-31 36.9 %
:RPS:PDB   1->259 2ej5A PDBj 4e-41 30.6 %
:RPS:SCOP  9->257 1uiyA  c.14.1.3 * 4e-45 30.0 %
:HMM:SCOP  2->260 1wdkA4 c.14.1.3 * 3.1e-67 37.5 %
:RPS:PFM   14->184 PF00378 * ECH 2e-18 39.1 %
:HMM:PFM   14->185 PF00378 * ECH 1.5e-35 35.9 170/170  
:BLT:SWISS 3->258 ECHA8_MYCTU 3e-30 36.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09668.1 GT:GENE ABF09668.1 GT:PRODUCT Enoyl-CoA hydratase/isomerase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3042145..3042927) GB:FROM 3042145 GB:TO 3042927 GB:DIRECTION - GB:PRODUCT Enoyl-CoA hydratase/isomerase GB:PROTEIN_ID ABF09668.1 GB:DB_XREF GI:93355579 InterPro:IPR001753 LENGTH 260 SQ:AASEQ MSDTVTFSREGSTAVVTLSNPGKLNAISVDMWQALAAGFATLAADMSLRCVLVRGADGNFAAGADIAEFPTVRGDEAAVRRYHTEIIAPALRAISECPHPTLAAIEGVCVGGGLEIACNCDLRVAAAGSRFGVPINRLGFPMAPGELRGLLALVGRAVTLEILLEGRVFDALEAERKGLLTRVVPAAAMHDEVTATVQRLSAGAPLAARINKTTIRRLSPDPTLLTDAEFDAHFRYATSRDHAEGVAAFLAHRPPDFTGE GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 3->258|ECHA8_MYCTU|3e-30|36.9|236/257| SEG 34->44|alaagfatlaa| BL:PDB:NREP 1 BL:PDB:REP 3->258|3h81B|9e-31|36.9|236/255| RP:PDB:NREP 1 RP:PDB:REP 1->259|2ej5A|4e-41|30.6|248/250| RP:PFM:NREP 1 RP:PFM:REP 14->184|PF00378|2e-18|39.1|169/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 14->185|PF00378|1.5e-35|35.9|170/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 9->257|1uiyA|4e-45|30.0|247/253|c.14.1.3| HM:SCP:REP 2->260|1wdkA4|3.1e-67|37.5|259/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 4408 OP:NHOMOORG 805 OP:PATTERN 22-1--5987888875-121211942231226-----------------------------1331-11 2445A114--2432HPGAA-AI33FRBABBBFNKPKDNdg1O2N1-14-111444334--88F-79EC5A4--------141A-----1111-1211--3-111153312--------------11111121111144443---37111111111111-1111111-1121111--1111--144323---6525555544646454443644326645B964411111119-111111111111111111111-1----1-----11---1-111111---1------------------------------------------1231111111212-2221221-2-1-3-11-551426-15---1--1-3--988E-1--151RGJ345NFOKF67756675776-33933I497AO-8332438865A9896E68A8367878G--------322-1BB4------------------------------AFRC-3aREPCDECLA84443888C666527EATLXcT23EE8956B9DAHGEQ329----55----------J993R9A1---------16862C12--25429332---------------------------351462637524333334822245273456---2-1-------42231226445654577-476754465645455655444422333444444444444444443434444--322222222222----222221111-573411111--11111111BAA8B386864177774855375775454-----------1-411111463444444444444------11553333-----------------------------------------------11 ----653-523-4359863766695846755455544956665654555798C88823432341----------1--------------46283431321325554-7A3GAB8BB85332682C7373Di7-97B2142834B7-475-93294456FAD55E833738B98774332O4433484495365485635 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 260 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEEccccccccccccHHcccHHHHHHHHHHHHHTHHHHHHHHHHccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEccGGGGTccccTTHHHHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEEEcGGGHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHTTTcccccccc DISOP:02AL 256-261| PSIPRED cccEEEEEEEccEEEEEEccHHHcccccHHHHHHHHHHHHHHHccccccEEEEEcccccEEccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //