[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09672.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->97 PF02089 * Palm_thioest 0.00056 35.2 71/279  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09672.1 GT:GENE ABF09672.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3046327..3046638) GB:FROM 3046327 GB:TO 3046638 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09672.1 GB:DB_XREF GI:93355583 LENGTH 103 SQ:AASEQ MRPKTTEKPNGKICTHAWVLERGQALGQRQHVKSDPRAPGASSPASMMLSSSGSFWRGQFSCGRQERCPPHLYPLYPHPIVVYRPHLTGLSDITVWRMADSRL GT:EXON 1|1-103:0| SEG 39->54|pgasspasmmlsssgs| SEG 69->79|pphlyplyphp| HM:PFM:NREP 1 HM:PFM:REP 25->97|PF02089|0.00056|35.2|71/279|Palm_thioest| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,28-47| PSIPRED ccccccccccccEEEEHHHHHHHHHHHHHHHcccccccccccccHHEEEcccccEEEEEccccccccccccccccccccEEEEEccccccccEEEEEEccccc //